Property Summary

NCBI Gene PubMed Count 51
Grant Count 46
R01 Count 26
Funding $3,650,313.82
PubMed Score 55.42
PubTator Score 53.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

 GO Function (1)

 GWAS Trait (1)

Gene RIF (40)

PMID Text
26517242 Suggest JAM3-M4 methylation as a biomarker for diagnosis of preneoplastic and neoplastic lesions of the cervix.
26311310 JAM-C inactivation in endothelial cells resulted in increased spreading on fibronectin and enhanced sprouting in vitro in a manner dependent on beta1-integrin and on the activation of the small GTPase RAP1.
24584816 indicate that JAM-C may be a therapeutic target for preventing and treating lymphatic metastases
24357068 Function of Jam-B/Jam-C interaction in homing and mobilization of human and mouse hematopoietic stem and progenitor cells.
23825230 These findings provide evidence for a role for endothelial cell JAM-C in tumor growth and aggressiveness as well as recruitment of pericytes to newly formed blood vessels in a model of ovarian cancer.
23277282 These data brought new evidences for the role of JAM2 and JAM3 in progression of gastric adenocarcinoma
23255084 Our study confirms the importance of JAM3 as a component of the junctional complexes and its deficiency leading to a distinctive and catastrophic neonatal presentation of cataracts and hemorrhagic destruction of the brain.
23221386 In the present study, we investigated the role of JAM-C in homing of human B cells, using a xenogeneic nonobese diabetic/severe combined immunodeficient mouse model.
21796628 Data suggest that the four-gene methylation panel might provide an alternative triage test after primary high-risk papillomavirus (hr-HPV) testing.
21593193 JAM-C expression was identified in human and murine melanoma cell lines, in human malignant melanoma, as well as in metastatic melanoma including melanoma lung metastasis
More...

AA Sequence

MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKI      1 - 70
QDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPV     71 - 140
TPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVH    141 - 210
KDDSGQYYCIASNDAGSARCEEQEMEVYDLNIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGE    211 - 280
SYKNPGKPDGVNYIRTDEEGDFRHKSSFVI                                            281 - 310
//

Text Mined References (54)

PMID Year Title
26517242 2015 JAM3 methylation status as a biomarker for diagnosis of preneoplastic and neoplastic lesions of the cervix.
26311310 2015 Endothelial-specific deficiency of Junctional Adhesion Molecule-C promotes vessel normalisation in proliferative retinopathy.
24584816 2014 JAM-C promotes lymphangiogenesis and nodal metastasis in non-small cell lung cancer.
24357068 2014 Function of Jam-B/Jam-C interaction in homing and mobilization of human and mouse hematopoietic stem and progenitor cells.
23825230 2013 Endothelial cell junctional adhesion molecule C plays a key role in the development of tumors in a murine model of ovarian cancer.
23277282 2013 Junctional adhesion molecules 2 and 3 may potentially be involved in progression of gastric adenocarcinoma tumors.
23255084 2013 Delineation of the clinical, molecular and cellular aspects of novel JAM3 mutations underlying the autosomal recessive hemorrhagic destruction of the brain, subependymal calcification, and congenital cataracts.
23221386 2013 Homing of human B cells to lymphoid organs and B-cell lymphoma engraftment are controlled by cell adhesion molecule JAM-C.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21796628 2012 A four-gene methylation marker panel as triage test in high-risk human papillomavirus positive patients.
More...