Property Summary

NCBI Gene PubMed Count 56
PubMed Score 97.09
PubTator Score 53.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (31)

Disease log2 FC p
aldosterone-producing adenoma -1.234 3.2e-02
Astrocytoma, Pilocytic 1.100 3.0e-02
atypical teratoid / rhabdoid tumor 1.300 1.5e-03
Breast cancer 3.100 2.8e-02
breast carcinoma -1.200 4.0e-34
Chronic Lymphocytic Leukemia -1.263 2.8e-04
colon cancer -1.600 1.0e-02
cystic fibrosis 1.195 2.9e-05
Duchenne muscular dystrophy 1.199 5.3e-10
ependymoma 1.400 4.1e-02
gastric cancer 1.200 5.5e-04
glioblastoma 1.600 1.5e-03
group 3 medulloblastoma 1.300 1.0e-02
intraductal papillary-mucinous carcinoma... -2.900 1.4e-04
intraductal papillary-mucinous neoplasm ... -2.600 3.3e-03
invasive ductal carcinoma -1.400 1.5e-03
lung adenocarcinoma -1.300 5.9e-14
malignant mesothelioma -2.000 1.8e-07
medulloblastoma, large-cell 2.400 5.0e-05
non-small cell lung cancer -1.023 1.6e-08
oligodendroglioma 1.200 5.4e-03
osteosarcoma 1.390 3.5e-03
ovarian cancer -1.700 1.7e-09
pancreatic cancer 1.200 6.6e-04
pancreatic carcinoma 1.200 6.6e-04
pediatric high grade glioma 1.100 2.9e-03
Pick disease -1.300 1.0e-03
primitive neuroectodermal tumor 1.300 2.0e-03
progressive supranuclear palsy -1.400 1.7e-02
psoriasis -2.100 7.8e-05
ulcerative colitis 1.100 5.6e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (46)

AA Sequence

MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKI      1 - 70
QDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPV     71 - 140
TPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVH    141 - 210
KDDSGQYYCIASNDAGSARCEEQEMEVYDLNIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGE    211 - 280
SYKNPGKPDGVNYIRTDEEGDFRHKSSFVI                                            281 - 310
//

Text Mined References (59)

PMID Year Title