Property Summary

NCBI Gene PubMed Count 53
PubMed Score 39.52
PubTator Score 25.88

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count
Diabetic Nephropathy 37
Disease Target Count P-value
non-small cell lung cancer 2798 6.43454307957134E-25
lung adenocarcinoma 2714 1.79795183498755E-15
ovarian cancer 8492 2.31510580793572E-10
Breast cancer 3099 4.83287868484006E-9
colon cancer 1475 7.11638227045138E-6
medulloblastoma, large-cell 6234 1.15260542440829E-5
invasive ductal carcinoma 2950 3.55992458525385E-5
psoriasis 6685 5.02851408073216E-5
ductal carcinoma in situ 1745 5.47486035380765E-5
malignant mesothelioma 3163 1.5008011254789E-4
group 3 medulloblastoma 2254 1.59839051587242E-4
adrenocortical carcinoma 1427 1.62258588717744E-4
breast carcinoma 1614 2.3382457624686E-4
atypical teratoid / rhabdoid tumor 4369 3.2028181005276E-4
Atopic dermatitis 944 4.72388843338455E-4
pituitary cancer 1972 9.37616486548686E-4
ependymoma 2514 0.00250499927231131
hereditary spastic paraplegia 313 0.00265848769747343
astrocytic glioma 2241 0.00323028821322094
oligodendroglioma 2849 0.00394578332577239
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00444962213412916
glioblastoma 5572 0.00857879870244788
active ulcerative colitis 477 0.0183373079197909
fibroadenoma 557 0.0252782942475313
lung cancer 4473 0.0320751155727352
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0


  Differential Expression (25)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
astrocytic glioma 2.000 0.003
ependymoma 2.400 0.003
oligodendroglioma 1.800 0.004
psoriasis -2.100 0.000
group 3 medulloblastoma -2.700 0.000
glioblastoma -1.200 0.009
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -4.800 0.000
hereditary spastic paraplegia -1.742 0.003
Atopic dermatitis -1.900 0.000
adrenocortical carcinoma -1.613 0.000
pancreatic ductal adenocarcinoma liver m... -1.734 0.004
non-small cell lung cancer -2.651 0.000
colon cancer -4.100 0.000
lung cancer -1.300 0.032
active ulcerative colitis -1.778 0.018
breast carcinoma -2.700 0.000
fibroadenoma -2.600 0.025
lung adenocarcinoma -1.500 0.000
Breast cancer -2.100 0.000
ductal carcinoma in situ -3.900 0.000
invasive ductal carcinoma -5.800 0.000
ovarian cancer 1.400 0.000
pituitary cancer -1.200 0.001

Gene RIF (26)

26962801 association between common SORBS1 genetic variations and blood pressure, presence of hypertension, and age at onset of hypertension
25476525 data suggest that SORBS1 might be a gene involved in diabetic nephropathy.
24878663 Our NMR and ITC data indicate that the SH3a and SH3b domains of CAP simultaneously bind to a long proline-rich region of vinculin with different binding specificities
24667918 Microarray analysis indicates HIV-1 Tat-induced downregulation of sorbin and SH3 domain containing 1 (SORBS1) in primary human brain microvascular endothelial cells
23892081 Sequestration of the ponsin splice variant R85FL by the polyglutamine-expanded Atx7 in cell is mediated by the specific SH3C-PRR interaction, which is implicated in the pathogenesis of spinocerebellar ataxia 7.
22235335 a novel signaling network containing FRS2, CAP and flotillin-1
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20129698 The novel ponsin isoform and its interaction with Nck1/2 provide exciting insight into the convergence of signalling pathways at the costameres, and its crucial role for skeletal muscle differentiation and re-generation.
19891780 Mutation of Tyr326 altered the function of CAP during cell spreading.

AA Sequence

MEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL                                         1261 - 1292

Text Mined References (62)

PMID Year Title
26962801 2016 Genetic Variation in the Human SORBS1 Gene is Associated With Blood Pressure Regulation and Age at Onset of Hypertension: A SAPPHIRe Cohort Study.
25476525 2015 SORBS1 gene, a new candidate for diabetic nephropathy: results from a multi-stage genome-wide association study in patients with type 1 diabetes.
24878663 2014 Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23892081 2013 Structural basis for recognition of the third SH3 domain of full-length R85 (R85FL)/ponsin by ataxin-7.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22235335 2012 Molecular networks in FGF signaling: flotillin-1 and cbl-associated protein compete for the binding to fibroblast growth factor receptor substrate 2.