Property Summary

NCBI Gene PubMed Count 53
PubMed Score 40.21
PubTator Score 25.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis -1.778 1.8e-02
adrenocortical carcinoma -1.613 1.6e-04
astrocytic glioma 2.000 3.2e-03
Atopic dermatitis -1.900 4.7e-04
atypical teratoid / rhabdoid tumor -3.000 3.2e-04
Breast cancer 1.500 3.6e-02
breast carcinoma -2.700 2.3e-04
colon cancer -1.700 4.8e-02
ductal carcinoma in situ -1.300 7.3e-03
ependymoma 2.400 2.5e-03
fibroadenoma -2.600 2.5e-02
glioblastoma -1.100 4.4e-02
group 3 medulloblastoma -1.300 4.8e-03
hereditary spastic paraplegia -1.742 2.7e-03
invasive ductal carcinoma -1.400 3.2e-02
lung adenocarcinoma -1.500 1.8e-15
lung cancer -1.300 3.2e-02
malignant mesothelioma 1.400 1.5e-04
medulloblastoma, large-cell -4.800 1.2e-05
non-small cell lung cancer -2.651 6.4e-25
oligodendroglioma 1.800 3.9e-03
ovarian cancer 1.400 2.3e-10
pancreatic ductal adenocarcinoma liver m... -1.679 1.6e-03
pituitary cancer -1.200 9.4e-04
psoriasis -2.100 5.0e-05

PDB (11)

Gene RIF (26)

AA Sequence

MSSECDGGSKAVMNGLAPGSNGQDKATADPLRARSISAVKIIPVKTVKNASGLVLPTDMDLTKICTGKGA      1 - 70
VTLRASSSYRETPSSSPASPQETRQHESKPGLEPEPSSADEWRLSSSADANGNAQPSSLAAKGYRSVHPN     71 - 140
LPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPPTPLGPLGCVPTIPATASAASPLTFPTLDDF    141 - 210
IPPHLQRWPHHSQPARASGSFAPISQTPPSFSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVS    211 - 280
SSLIGTDSQAFPSVSKPSSAYPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDSAPTQEKPTS    281 - 350
PGKAIEKRAKDDSRRVVKSTQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYK    351 - 420
FPELPEIQQTSEEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSKSEMSYIDGEK    421 - 490
VVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTRKYRAEPKSIYEYQPGKSSVLTNEKMSRDISPEEI    491 - 560
DLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDRKTNLDKDLSLCQTELEADLEKMETLNKAPS    561 - 630
ANVPQSSAISPTPEISSETPGYIYSSNFHAVKRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLK    631 - 700
RPSSSASTKDSESPRHFIPADYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQ    701 - 770
FITNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVG    771 - 840
IFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIP    841 - 910
GTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSPSRSATASPQFSSHSKLITPAPSSLPHSRRALSPE    911 - 980
MHAVTSEWISLTVGVPGRRSLALTPPLPPLPEASIYNTDHLALSPRASPSLSLSLPHLSWSDRPTPRSVA    981 - 1050
SPLALPSPHKTYSLAPTSQASLHMNGDGGVHTPSSGIHQDSFLQLPLGSSDSVISQLSDAFSSQSKRQPW   1051 - 1120
REESGQYERKAERGAGERGPGGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFPGSEA   1121 - 1190
EQTERHRGGEQAGRKAARRGGSQQPQAQQRRVTPDRSQTSQDLFSYQALYSYIPQNDDELELRDGDIVDV   1191 - 1260
MEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL                                         1261 - 1292
//

Text Mined References (62)

PMID Year Title