Property Summary

NCBI Gene PubMed Count 110
Grant Count 57
R01 Count 38
Funding $5,388,849.52
PubMed Score 73.28
PubTator Score 111.56

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BX63 Q3MJE2 Q8NCI5 Protein FACJ
Symbols OF
BACH1
FANCJ

Gene

PDB

1T15   1T29   3AL3  

Gene RIF (101)

PMID Text
26709662 BRIP1 might be the gene involved in the onset of breast cancer in families that do not show BRACA1/2 mutations (Review)
26637282 Fancj helicase-deficient mice, while phenotypically resembling Fanconi anemia (FA), are also hypersensitive to replication inhibitors and predisposed to lymphoma
26336824 FANCJ protein is important for the stability of FANCD2/FANCI proteins and protects them from proteasome and caspase-3 dependent degradation.
26315354 Deleterious germline mutations in BRIP1 are associated with a moderate increase in the risk of EOC Epithelial Ovarian Cancer).
26055704 our data point to the existence of a functional interplay between hMSH5 and FANCJ in double-strand break repair induced by replication stress.
25659033 FANCJ and BRCA2 share FANCD2's role in replication fork restart.
25483079 In coordination with BRCA1, FancJ promotes DNA damage-induced centrosome amplification in DNA damaged cells.
25070891 Our results suggest not only that FANCD2 regulates FANCJ chromatin localization but also that FANCJ is necessary for efficient loading of FANCD2 onto chromatin following DNA damage caused by mitomycin C treatment.
25045080 Genetic variants in BRIP1 (BACH1) contribute to risk of nonsyndromic cleft lip with or without cleft palate.
24966277 FANCJ-MLH1 interaction is important for DNA damage responses.
More...

AA Sequence

MSSMWSEYTIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSALAWQQSLSGK      1 - 70
PADEGVSEKAEVQLSCCCACHSKDFTNNDMNQGTSRHFNYPSTPPSERNGTSSTCQDSPEKTTLAAKLSA     71 - 140
KKQASIYRDENDDFQVEKKRIRPLETTQQIRKRHCFGTEVHNLDAKVDSGKTVKLNSPLEKINSFSPQKP    141 - 210
PGHCSRCCCSTKQGNSQESSNTIKKDHTGKSKIPKIYFGTRTHKQIAQITRELRRTAYSGVPMTILSSRD    211 - 280
HTCVHPEVVGNFNRNEKCMELLDGKNGKSCYFYHGVHKISDQHTLQTFQGMCKAWDIEELVSLGKKLKAC    281 - 350
PYYTARELIQDADIIFCPYNYLLDAQIRESMDLNLKEQVVILDEAHNIEDCARESASYSVTEVQLRFARD    351 - 420
ELDSMVNNNIRKKDHEPLRAVCCSLINWLEANAEYLVERDYESACKIWSGNEMLLTLHKMGITTATFPIL    421 - 490
QGHFSAVLQKEEKISPIYGKEEAREVPVISASTQIMLKGLFMVLDYLFRQNSRFADDYKIAIQQTYSWTN    491 - 560
QIDISDKNGLLVLPKNKKRSRQKTAVHVLNFWCLNPAVAFSDINGKVQTIVLTSGTLSPMKSFSSELGVT    561 - 630
FTIQLEANHIIKNSQVWVGTIGSGPKGRNLCATFQNTETFEFQDEVGALLLSVCQTVSQGILCFLPSYKL    631 - 700
LEKLKERWLSTGLWHNLELVKTVIVEPQGGEKTNFDELLQVYYDAIKYKGEKDGALLVAVCRGKVSEGLD    701 - 770
FSDDNARAVITIGIPFPNVKDLQVELKRQYNDHHSKLRGLLPGRQWYEIQAYRALNQALGRCIRHRNDWG    771 - 840
ALILVDDRFRNNPSRYISGLSKWVRQQIQHHSTFESALESLAEFSKKHQKVLNVSIKDRTNIQDNESTLE    841 - 910
VTSLKYSTPPYLLEAASHLSPENFVEDEAKICVQELQCPKIITKNSPLPSSIISRKEKNDPVFLEEAGKA    911 - 980
EKIVISRSTSPTFNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFT    981 - 1050
DKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRD   1051 - 1120
FETEAEDESIYFTPELYDPEDTDEEKNDLAETDRGNRLANNSDCILAKDLFEIRTIKEVDSAREVKAEDC   1121 - 1190
IDTKLNGILHIEESKIDDIDGNVKTTWINELELGKTHEIEIKNFKPSPSKNKGMFPGFK              1191 - 1249
//

Text Mined References (114)

PMID Year Title
26709662 2016 BRIP1, a potential candidate gene in development of non-BRCA1/2 breast cancer.
26637282 2015 FANCJ suppresses microsatellite instability and lymphomagenesis independent of the Fanconi anemia pathway.
26336824 2015 FANCJ protein is important for the stability of FANCD2/FANCI proteins and protects them from proteasome and caspase-3 dependent degradation.
26315354 2015 Germline Mutations in the BRIP1, BARD1, PALB2, and NBN Genes in Women With Ovarian Cancer.
26055704 2015 hMSH5 Facilitates the Repair of Camptothecin-induced Double-strand Breaks through an Interaction with FANCJ.
25659033 2015 FANCD2, FANCJ and BRCA2 cooperate to promote replication fork recovery independently of the Fanconi Anemia core complex.
25483079 2014 BRCA1 and FancJ cooperatively promote interstrand crosslinker induced centrosome amplification through the activation of polo-like kinase 1.
25070891 2014 The Fanconi anemia proteins FANCD2 and FANCJ interact and regulate each other's chromatin localization.
25045080 2014 Genetic variants in BRIP1 (BACH1) contribute to risk of nonsyndromic cleft lip with or without cleft palate.
24966277 2014 Crosstalk between BRCA-Fanconi anemia and mismatch repair pathways prevents MSH2-dependent aberrant DNA damage responses.
More...