Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.14
PubTator Score 7.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.364 1.5e-04
medulloblastoma, large-cell -1.300 5.7e-05
tuberculosis 1.300 8.7e-06
atypical teratoid/rhabdoid tumor -1.300 1.0e-05
group 4 medulloblastoma -1.100 7.1e-04
non primary Sjogren syndrome sicca 1.100 4.3e-02

 GO Function (1)

Gene RIF (10)

PMID Text
26869717 These results support a role of TAPBPR in stabilizing peptide-receptive conformation(s) of MHC-I, permitting peptide editing.
26439010 It is now clear there are two MHC class I specific peptide editors, tapasin and TAPBPR, intimately involved in controlling peptide presentation to the immune system.
25720504 TAPBPR is a new player in the MHC class I presentation pathway. (Review)
24444341 The longer TAPBPR protein interacted with MHC class I but was attenuated in its ability to down-regulate surface expression of MHC class I.
24163410 the data indicate that TAPBPR and tapasin bind in a similar orientation to the same face of MHC class I.
23401559 The function of the tapasin-related protein, TAPBPR, was investigated.
21362330 HLA-I, TAP1, CNX, LMP7, Erp57, Tapasin and ERAP1 were down-regulated in 68%, 44%, 48%, 40%, 52%, 32% and 20% of esophageal squamous cell carcinoma lesions then, respectively.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
18340469 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGTQEGWCLLLCLALSGAAETKPHPAEGQWRAVDVVLDCFLAKDGAHRGALASSEDRARASLVLKQVPVL      1 - 70
DDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVTCEISRYFLQMTETTVKTAA     71 - 140
WFMANMQVSGGGPSISLVMKTPRVTKNEALWHPTLNLPLSPQGTVRTAVEFQVMTQTQSLSFLLGSSASL    141 - 210
DCGFSMAPGLDLISVEWRLQHKGRGQLVYSWTAGQGQAVRKGATLEPAQLGMARDASLTLPGLTIQDEGT    211 - 280
YICQITTSLYRAQQIIQLNIQASPKVRLSLANEALLPTLICDIAGYYPLDVVVTWTREELGGSPAQVSGA    281 - 350
SFSSLRQSVAGTYSISSSLTAEPGSAGATYTCQVTHISLEEPLGASTQVVPPERRTALGVIFASSLFLLA    351 - 420
LMFLGLQRRQAPTGLGLLQAERWETTSCADTQSSHLHEDRTARVSQPS                          421 - 468
//

Text Mined References (18)

PMID Year Title
26869717 2016 Interaction of TAPBPR, a tapasin homolog, with MHC-I molecules promotes peptide editing.
26439010 2015 TAPBPR alters MHC class I peptide presentation by functioning as a peptide exchange catalyst.
25720504 2015 TAPBPR: a new player in the MHC class I presentation pathway.
24444341 2014 TAPBPR isoforms exhibit altered association with MHC class I.
24163410 2013 The binding of TAPBPR and Tapasin to MHC class I is mutually exclusive.
23401559 2013 Tapasin-related protein TAPBPR is an additional component of the MHC class I presentation pathway.
21362330 2011 Association of defective HLA-I expression with antigen processing machinery and their association with clinicopathological characteristics in Kazak patients with esophageal cancer.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18340469 2008 Further examination of the candidate genes in chromosome 12p13 locus for late-onset Alzheimer disease.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11920573 2002 A human TAPBP (TAPASIN)-related gene, TAPBP-R.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.