Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
Funding $457,115.25
PubMed Score 5.14
PubTator Score 7.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.364 0.000
medulloblastoma, large-cell -1.300 0.000
tuberculosis 1.300 0.000
atypical teratoid/rhabdoid tumor -1.300 0.000
group 4 medulloblastoma -1.100 0.001
non primary Sjogren syndrome sicca 1.100 0.043

 GO Function (1)

Gene RIF (10)

PMID Text
26869717 These results support a role of TAPBPR in stabilizing peptide-receptive conformation(s) of MHC-I, permitting peptide editing.
26439010 It is now clear there are two MHC class I specific peptide editors, tapasin and TAPBPR, intimately involved in controlling peptide presentation to the immune system.
25720504 TAPBPR is a new player in the MHC class I presentation pathway. (Review)
24444341 The longer TAPBPR protein interacted with MHC class I but was attenuated in its ability to down-regulate surface expression of MHC class I.
24163410 the data indicate that TAPBPR and tapasin bind in a similar orientation to the same face of MHC class I.
23401559 The function of the tapasin-related protein, TAPBPR, was investigated.
21362330 HLA-I, TAP1, CNX, LMP7, Erp57, Tapasin and ERAP1 were down-regulated in 68%, 44%, 48%, 40%, 52%, 32% and 20% of esophageal squamous cell carcinoma lesions then, respectively.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
18340469 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGTQEGWCLLLCLALSGAAETKPHPAEGQWRAVDVVLDCFLAKDGAHRGALASSEDRARASLVLKQVPVL      1 - 70
DDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVTCEISRYFLQMTETTVKTAA     71 - 140
WFMANMQVSGGGPSISLVMKTPRVTKNEALWHPTLNLPLSPQGTVRTAVEFQVMTQTQSLSFLLGSSASL    141 - 210
DCGFSMAPGLDLISVEWRLQHKGRGQLVYSWTAGQGQAVRKGATLEPAQLGMARDASLTLPGLTIQDEGT    211 - 280
YICQITTSLYRAQQIIQLNIQASPKVRLSLANEALLPTLICDIAGYYPLDVVVTWTREELGGSPAQVSGA    281 - 350
SFSSLRQSVAGTYSISSSLTAEPGSAGATYTCQVTHISLEEPLGASTQVVPPERRTALGVIFASSLFLLA    351 - 420
LMFLGLQRRQAPTGLGLLQAERWETTSCADTQSSHLHEDRTARVSQPS                          421 - 468
//

Text Mined References (18)

PMID Year Title
26869717 2016 Interaction of TAPBPR, a tapasin homolog, with MHC-I molecules promotes peptide editing.
26439010 2015 TAPBPR alters MHC class I peptide presentation by functioning as a peptide exchange catalyst.
25720504 2015 TAPBPR: a new player in the MHC class I presentation pathway.
24444341 2014 TAPBPR isoforms exhibit altered association with MHC class I.
24163410 2013 The binding of TAPBPR and Tapasin to MHC class I is mutually exclusive.
23401559 2013 Tapasin-related protein TAPBPR is an additional component of the MHC class I presentation pathway.
21362330 2011 Association of defective HLA-I expression with antigen processing machinery and their association with clinicopathological characteristics in Kazak patients with esophageal cancer.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18340469 2008 Further examination of the candidate genes in chromosome 12p13 locus for late-onset Alzheimer disease.
More...