Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.65
PubTator Score 2032.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
heavy drinking 5
Disease Target Count P-value
non-small cell lung cancer 2890 2.7e-18
lung carcinoma 2843 3.1e-10
malignant mesothelioma 3232 3.8e-07
osteosarcoma 7950 1.2e-05
lung cancer 4740 1.1e-03
active Crohn's disease 922 1.7e-02
nephrosclerosis 333 3.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (7)

Disease log2 FC p
active Crohn's disease -1.308 1.7e-02
lung cancer -1.300 1.1e-03
lung carcinoma -1.200 3.1e-10
malignant mesothelioma 2.100 3.8e-07
nephrosclerosis -1.091 3.7e-02
non-small cell lung cancer -2.293 2.7e-18
osteosarcoma -1.615 1.2e-05

AA Sequence

MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSG      1 - 70
ILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALA     71 - 140
IIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGW    141 - 210
AAASDSRKGGEPAGY                                                           211 - 225
//

Text Mined References (9)

PMID Year Title