Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.65
PubTator Score 2032.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 2.68769019000613E-18
lung carcinoma 2844 3.12205976404467E-10
malignant mesothelioma 3163 3.82633991192825E-7
osteosarcoma 7933 1.15264177664043E-5
lung cancer 4473 0.00113512906818054
active Crohn's disease 918 0.0172001793550258
nephrosclerosis 329 0.0367057204859072

Synonym

Accession Q9BX51 D3DW43 Q08246
Symbols GGTL6
GGTLA3
GGTLA4
dJ831C21.1
dJ831C21.2

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source
Chimp OMA EggNOG

AA Sequence

MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSG      1 - 70
ILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALA     71 - 140
IIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGW    141 - 210
AAASDSRKGGEPAGY                                                           211 - 225
//

Text Mined References (9)

PMID Year Title
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
18357469 2008 The human gamma-glutamyltransferase gene family.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10843999 2000 Molecular characterization of human acetyl-CoA synthetase, an enzyme regulated by sterol regulatory element-binding proteins.
7689219 1993 Human lung expresses unique gamma-glutamyl transpeptidase transcripts.