Property Summary

NCBI Gene PubMed Count 10
Grant Count 3
R01 Count 3
Funding $111,696.88
PubMed Score 11.25
PubTator Score 4.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.300 0.003
oligodendroglioma -2.000 0.000
glioblastoma multiforme -1.800 0.000
cystic fibrosis -1.579 0.000
medulloblastoma, large-cell -1.800 0.028
interstitial cystitis -2.000 0.005
pediatric high grade glioma -1.400 0.038
group 4 medulloblastoma 2.700 0.001
pilocytic astrocytoma -2.200 0.000
posterior fossa group B ependymoma 1.300 0.006
subependymal giant cell astrocytoma 3.213 0.026
nasopharyngeal carcinoma -2.100 0.000
ovarian cancer 1.400 0.005
pituitary cancer -1.800 0.001
chronic rhinosinusitis -1.520 0.028

Gene RIF (3)

PMID Text
24375645 Study suggests that p63 is regulated by RBM24 via mRNA stability, which gives an insight into understanding how posttranscriptional regulatory mechanisms contribute to p63 expression.
24356969 Rbm24 is a novel player in the p53 pathway, which may be explored to restore proper cell cycle control in p53-deficient tumors via p21.
19817877 it was found that this protein Rbm24 regulates myogenic differentiation via the p21 signal pathway.

AA Sequence

MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACK      1 - 70
DPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQLHPALIQRPFGIPAHYVYPQAFVQPGVVIPHVQPT     71 - 140
AAAASTTPYIDYTGAAYAQYSAAAAAAAAAAAYDQYPYAASPAAAGYVTAGGYGYAVQQPITAAAPGTAA    141 - 210
AAAAAAAAAAAFGQYQPQQLQTDRMQ                                                211 - 236
//

Text Mined References (11)

PMID Year Title
24375645 2014 RNA-binding protein RBM24 regulates p63 expression via mRNA stability.
24356969 2014 Rbm24, an RNA-binding protein and a target of p53, regulates p21 expression via mRNA stability.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
20977548 2010 RNA-binding motif protein 24 regulates myogenin expression and promotes myogenic differentiation.
19817877 2009 RNA-binding proteins Rbm38 and Rbm24 regulate myogenic differentiation via p21-dependent and -independent regulatory pathways.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...