Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.94
PubTator Score 4.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.021
psoriasis -2.300 0.000
osteosarcoma -2.020 0.000
atypical teratoid / rhabdoid tumor -1.200 0.002
glioblastoma -1.100 0.009
adult high grade glioma -1.300 0.006
group 3 medulloblastoma 1.400 0.025

Gene RIF (1)

PMID Text
18976975 Knockdown of LSM14B, SCD6 homolog B by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSGSSGTPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFR      1 - 70
GSDIKDITVCEPPKAQHTLPQDPAIVQSSLGSASASPFQPHVPYSPFRGMAPYGPLAASSLLSQQYAASL     71 - 140
GLGAGFPSIPVGKSPMVEQAVQTGSADNLNAKKLLPGKGTTGTQLNGRQAQPSSKTASDVVQPAAVQAQG    141 - 210
QVNDENRRPQRRRSGNRRTRNRSRGQNRPTNVKENTIKFEGDFDFESANAQFNREELDKEFKKKLNFKDD    211 - 280
KAEKGEEKDLAVVTQSAEAPAEEDLLGPNCYYDKSKSFFDNISSELKTSSRRTTWAEERKLNTETFGVSG    281 - 350
RFLRGRSSRGGFRGGRGNGTTRRNPTSHRAGTGRV                                       351 - 385
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18723115 2009 RAP55: insights into an evolutionarily conserved protein family.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15225602 2004 Novel Sm-like proteins with long C-terminal tails and associated methyltransferases.
More...