Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.05
PubTator Score 1.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 3.9e-03
glioblastoma 1.100 1.6e-02
intraductal papillary-mucinous neoplasm ... 1.100 2.6e-02
juvenile dermatomyositis 1.328 3.3e-08
malignant mesothelioma 1.100 3.1e-06
X-linked cerebral adrenoleukodystrophy 1.100 4.6e-02

Gene RIF (1)

AA Sequence

MDSRVSELFGGCCRPGGGPAVGGTLKARGAGSSSGCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEY      1 - 70
KLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITV     71 - 140
LREREVDYDSDMPRKITEVLVRKVPDNQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARLNLFR    141 - 210
HLHEIQSGRTSSISFEILGFNSKGEVVNYSDSRTAEEICESSSKMITFIDLAGHHKYLHTTIFGLTSYCP    211 - 280
DCALLLVSANTGIAGTTREHLGLALALKVPFFIVVSKIDLCAKTTVERTVRQLERVLKQPGCHKVPMLVT    281 - 350
SEDDAVTAAQQFAQSPNVTPIFTLSSVSGESLDLLKVFLNILPPLTNSKEQEELMQQLTEFQVDEIYTVP    351 - 420
EVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALGDFDRALLRKG    421 - 490
MVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTGEKAVVRFRFL    491 - 560
KHPEYLKVGAKLLFREGVTKGIGHVTDVQAITAGEAQANMGF                                561 - 602
//

Text Mined References (11)

PMID Year Title