Property Summary

NCBI Gene PubMed Count 9
Grant Count 11
R01 Count 11
Funding $527,560.32
PubMed Score 4.93
PubTator Score 1.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

AA Sequence

MDSRVSELFGGCCRPGGGPAVGGTLKARGAGSSSGCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEY      1 - 70
KLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITV     71 - 140
LREREVDYDSDMPRKITEVLVRKVPDNQQFLDLRVAVLGNVDSGKSTLLGVLTQGELDNGRGRARLNLFR    141 - 210
HLHEIQSGRTSSISFEILGFNSKGEVVNYSDSRTAEEICESSSKMITFIDLAGHHKYLHTTIFGLTSYCP    211 - 280
DCALLLVSANTGIAGTTREHLGLALALKVPFFIVVSKIDLCAKTTVERTVRQLERVLKQPGCHKVPMLVT    281 - 350
SEDDAVTAAQQFAQSPNVTPIFTLSSVSGESLDLLKVFLNILPPLTNSKEQEELMQQLTEFQVDEIYTVP    351 - 420
EVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALGDFDRALLRKG    421 - 490
MVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTGEKAVVRFRFL    491 - 560
KHPEYLKVGAKLLFREGVTKGIGHVTDVQAITAGEAQANMGF                                561 - 602
//

Text Mined References (10)

PMID Year Title
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11054535 2000 Cloning, expression analysis, and chromosomal mapping of GTPBP2, a novel member of the G protein family.
10833435 2000 Mouse and human GTPBP2, newly identified members of the GP-1 family of GTPase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.