Property Summary

NCBI Gene PubMed Count 44
PubMed Score 86.11
PubTator Score 54.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma -1.075 2.0e-03
aldosterone-producing adenoma -1.223 6.8e-03
interstitial cystitis -1.700 6.4e-03
ovarian cancer -2.100 7.1e-16
psoriasis -1.700 4.4e-05

Gene RIF (35)

AA Sequence

MYQSLALAASPRQAAYADSGSFLHAPGAGSPMFVPPARVPSMLSYLSGCEPSPQPPELAARPGWAQTATA      1 - 70
DSSAFGPGSPHPPAAHPPGATAFPFAHSPSGPGSGGSAGGRDGSAYQGALLPREQFAAPLGRPVGTSYSA     71 - 140
TYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRECVNCGALSTPLWRRDGTGHYLC    141 - 210
NACGLYHKMNGVNRPLVRPQKRLSSSRRAGLCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPL    211 - 280
AMKKESIQTRKRKPKTIAKARGSSGSTRNASASPSAVASTDSSAATSKAKPSLASPVCPGPSMAPQASGQ    281 - 350
EDDSLAPGHLEFKFEPEDFAFPSTAPSPQAGLRGALRQEAWCALALA                           351 - 397
//

Text Mined References (44)

PMID Year Title