Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.20
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
20691427 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
11374903 APOL5 has been found only in humans

AA Sequence

MPCGKQGNLQVPGSKVLPGLGEGCKEMWLRKVIYGGEVWGKSPEPEFPSLVNLCQSWKINNLMSTVHSDE      1 - 70
AGMLSYFLFEELMRCDKDSMPDGNLSEEEKLFLSYFPLHKFELEQNIKELNTLADQVDTTHELLTKTSLV     71 - 140
ASSSGAVSGVMNILGLALAPVTAGGSLMLSATGTGLGAAAAITNIVTNVLENRSNSAARDKASRLGPLTT    141 - 210
SHEAFGGINWSEIEAAGFCVNKCVKAIQGIKDLHAYQMAKSNSGFMAMVKNFVAKRHIPFWTARGVQRAF    211 - 280
EGTTLAMTNGAWVMGAAGAGFLLMKDMSSFLQSWKHLEDGARTETAEELRALAKKLEQELDRLTQHHRHL    281 - 350
PQKASQTCSSSRGRAVRGSRVVKPEGSRSPLPWPVVEHQPRLGPGVALRTPKRTVSAPRMLGHQPAPPAP    351 - 420
ARKGRQAPGRHRQ                                                             421 - 433
//

Text Mined References (6)

PMID Year Title
24348519 2013 EMR-linked GWAS study: investigation of variation landscape of loci for body mass index in children.
20691427 2010 Genetic associations of brain structural networks in schizophrenia: a preliminary study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
11374903 2001 The human apolipoprotein L gene cluster: identification, classification, and sites of distribution.
10591208 1999 The DNA sequence of human chromosome 22.