Property Summary

NCBI Gene PubMed Count 7
Grant Count 26
R01 Count 10
Funding $2,738,912.77
PubMed Score 132.52
PubTator Score 27.02

Knowledge Summary

Patent

No data available

AA Sequence

MPRSFLVKKVKLDAFSSADLESAYGRARSDLGAPLHDKGYLSDYVGPSSVYDGDAEAALLKGPSPEPMYA      1 - 70
AAVRGELGPAAAGSAPPPTPRPELATAAGGYINGDAAVSEGYAADAFFITDGRSRRKASNAGSAAAPSTA     71 - 140
SAAAPDGDAGGGGGAGGRSLGSGPGGRGGTRAGAGTEARAGPGAAGAGGRHACGECGKTYATSSNLSRHK    141 - 210
QTHRSLDSQLARRCPTCGKVYVSMPAMAMHLLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAH    211 - 280
CGKAFADRSNLRAHMQTHSAFKHFQCKRCKKSFALKSYLNKHYESACFKGGAGGPAAPAPPQLSPVQA      281 - 348
//

Text Mined References (7)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
20043117 2010 The SNAIL family member SCRATCH1 is not expressed in human tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11687288 2001 Mammalian Scratch participates in neuronal differentiation in P19 embryonal carcinoma cells.
11274425 2001 Mammalian Scratch: a neural-specific Snail family transcriptional repressor.
11181995 2001 The sequence of the human genome.