Property Summary

NCBI Gene PubMed Count 14
PubMed Score 34.09
PubTator Score 12.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.200 4.1e-03
astrocytic glioma -1.500 1.2e-03
Astrocytoma, Pilocytic -1.300 2.2e-05
Gaucher disease type 1 1.700 5.7e-03
glioblastoma -1.100 6.5e-04
medulloblastoma, large-cell 1.400 4.5e-05
oligodendroglioma -1.300 1.7e-15
osteosarcoma -2.164 1.1e-04
ovarian cancer -2.000 9.6e-07
pancreatic cancer 1.100 6.6e-03
primary pancreatic ductal adenocarcinoma 1.234 1.5e-02
psoriasis -3.700 2.8e-06
subependymal giant cell astrocytoma -1.636 3.6e-02
tuberculosis 1.700 7.5e-07

Protein-protein Interaction (6)

Gene RIF (5)

AA Sequence

MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLY      1 - 70
CAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNP     71 - 140
SSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMG    141 - 210
PMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPI    211 - 280
MPSPADSTNSSDNIYTMINPVPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNN    281 - 350
ISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV                                    351 - 388
//

Text Mined References (25)

PMID Year Title