Property Summary

NCBI Gene PubMed Count 13
Grant Count 14
R01 Count 14
Funding $5,839,936.67
PubMed Score 32.69
PubTator Score 12.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.500 0.001
psoriasis -3.700 0.000
glioblastoma -1.700 0.000
oligodendroglioma -1.300 0.000
osteosarcoma -2.339 0.000
medulloblastoma, large-cell 1.400 0.000
primary pancreatic ductal adenocarcinoma 1.234 0.015
tuberculosis 1.700 0.000
adult high grade glioma -1.200 0.004
pilocytic astrocytoma -1.300 0.000
subependymal giant cell astrocytoma -2.902 0.025
ovarian cancer -2.000 0.000
Gaucher disease type 1 1.700 0.006
pancreatic cancer 1.100 0.007

Gene RIF (5)

PMID Text
26495868 SSBP3 Interacts With Islet-1 and Ldb1 to Impact Pancreatic beta-Cell Target Genes
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18080319 phosphorylation involving N-terminal tyrosine residues of Ssdp1 is a means of regulating its nuclear localization and subsequent transcriptional activation of LIM-HD complexes.
16325762 Thus, biochemical data of SSDP1 presented by this study provides biochemical evidence for a better understanding of transcriptional regulation.
12381786 Ssdp proteins interact with the LIM-domain-binding protein Ldb1 to regulate development

AA Sequence

MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLY      1 - 70
CAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNP     71 - 140
SSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMG    141 - 210
PMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPI    211 - 280
MPSPADSTNSSDNIYTMINPVPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNN    281 - 350
ISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV                                    351 - 388
//

Text Mined References (24)

PMID Year Title
26495868 2015 SSBP3 Interacts With Islet-1 and Ldb1 to Impact Pancreatic ?-Cell Target Genes.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...