Property Summary

NCBI Gene PubMed Count 13
PubMed Score 32.69
PubTator Score 12.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 1.70006758509266E-15
tuberculosis 1563 7.52010389022032E-7
ovarian cancer 8492 9.55981525758787E-7
psoriasis 6685 2.77348674469341E-6
pilocytic astrocytoma 3086 2.07537428785467E-5
medulloblastoma, large-cell 6234 4.45446590616159E-5
osteosarcoma 7933 2.64005376008346E-4
glioblastoma 5572 4.44583269229789E-4
astrocytic glioma 2241 0.00120491787945863
adult high grade glioma 2148 0.00411448470827734
Gaucher disease type 1 171 0.00570676186836963
pancreatic cancer 2300 0.00657175266564916
primary pancreatic ductal adenocarcinoma 1271 0.0148391503886602
subependymal giant cell astrocytoma 2287 0.0246361108616176
Disease Target Count Z-score Confidence
Prostate carcinoma in situ 11 4.42 2.2

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.500 0.001
psoriasis -3.700 0.000
glioblastoma -1.700 0.000
oligodendroglioma -1.300 0.000
osteosarcoma -2.339 0.000
medulloblastoma, large-cell 1.400 0.000
primary pancreatic ductal adenocarcinoma 1.234 0.015
tuberculosis 1.700 0.000
adult high grade glioma -1.200 0.004
pilocytic astrocytoma -1.300 0.000
subependymal giant cell astrocytoma -2.902 0.025
ovarian cancer -2.000 0.000
Gaucher disease type 1 1.700 0.006
pancreatic cancer 1.100 0.007

Synonym

Accession Q9BWW4 A8K0A9 Q5T860 Q5T861 Q9BTM0 Q9BWW3
Symbols CSDP
SSDP
SSDP1

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG

 GWAS Trait (1)

Gene RIF (5)

PMID Text
26495868 SSBP3 Interacts With Islet-1 and Ldb1 to Impact Pancreatic beta-Cell Target Genes
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18080319 phosphorylation involving N-terminal tyrosine residues of Ssdp1 is a means of regulating its nuclear localization and subsequent transcriptional activation of LIM-HD complexes.
16325762 Thus, biochemical data of SSDP1 presented by this study provides biochemical evidence for a better understanding of transcriptional regulation.
12381786 Ssdp proteins interact with the LIM-domain-binding protein Ldb1 to regulate development

AA Sequence

MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLY      1 - 70
CAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNP     71 - 140
SSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMG    141 - 210
PMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPI    211 - 280
MPSPADSTNSSDNIYTMINPVPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNN    281 - 350
ISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV                                    351 - 388
//

Text Mined References (24)

PMID Year Title
26495868 2015 SSBP3 Interacts With Islet-1 and Ldb1 to Impact Pancreatic ?-Cell Target Genes.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...