Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.88
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.600 0.024
osteosarcoma -2.826 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.600 0.000
adult high grade glioma -1.400 0.000
ovarian cancer 1.700 0.000

Gene RIF (2)

PMID Text
26945630 NYD-SP15 contained nuclear localization sequence and nuclear export-signal and could dynamically shuttle between the nucleus and cytoplasm.
16955368 NYD-SP15 protein plays an important role in testicular development and spermatogenesis

AA Sequence

MKEAGQMQNLESARAGRSVSTQTGSMTGQIPRLSKVNLFTLLSLWMELFPAEAQRQKSQKNEEGKHGPLG      1 - 70
DNEERTRVSTDKRQVKRTGLVVVKNMKIVGLHCSSEDLHAGQIALIKHGSRLKNCDLYFSRKPCSACLKM     71 - 140
IVNAGVNRISYWPADPEISLLTEASSSEDAKLDAKAVERLKSNSRAHVCVLLQPLVCYMVQFVEETSYKC    141 - 210
DFIQKITKTLPDANTDFYYECKQERIKEYEMLFLVSNEEMHKQILMTIGLENLCENPYFSNLRQNMKDLI    211 - 280
LLLATVASSVPNFKHFGFYRSNPEQINEIHNQSLPQEIARHCMVQARLLAYRTEDHKTGVGAVIWAEGKS    281 - 350
RSCDGTGAMYFVGCGYNAFPVGSEYADFPHMDDKQKDREIRKFRYIIHAEQNALTFRCQEIKPEERSMIF    351 - 420
VTKCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRE    421 - 490
NGVLRPVPQKEEQHQDKKLRLGIH                                                  491 - 514
//

Text Mined References (8)

PMID Year Title
26945630 2016 Structural and biological function of NYD-SP15 as a new member of cytidine deaminases.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16955368 2006 NYD-SP15: a novel gene potentially involved in regulating testicular development and spermatogenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.