Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.98
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 4.1e-04
astrocytic glioma -1.400 1.1e-02
atypical teratoid / rhabdoid tumor -1.100 1.1e-05
glioblastoma -1.200 1.5e-04
medulloblastoma, large-cell -1.500 1.1e-05
osteosarcoma -2.826 2.6e-08
ovarian cancer 1.700 4.2e-04

Synonym

Accession Q9BWV3 Q49A08 Q4G119 Q5TAW9 Q7Z764 Q9NT36
Symbols NYD-SP15
bA103J18.1

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MKEAGQMQNLESARAGRSVSTQTGSMTGQIPRLSKVNLFTLLSLWMELFPAEAQRQKSQKNEEGKHGPLG      1 - 70
DNEERTRVSTDKRQVKRTGLVVVKNMKIVGLHCSSEDLHAGQIALIKHGSRLKNCDLYFSRKPCSACLKM     71 - 140
IVNAGVNRISYWPADPEISLLTEASSSEDAKLDAKAVERLKSNSRAHVCVLLQPLVCYMVQFVEETSYKC    141 - 210
DFIQKITKTLPDANTDFYYECKQERIKEYEMLFLVSNEEMHKQILMTIGLENLCENPYFSNLRQNMKDLI    211 - 280
LLLATVASSVPNFKHFGFYRSNPEQINEIHNQSLPQEIARHCMVQARLLAYRTEDHKTGVGAVIWAEGKS    281 - 350
RSCDGTGAMYFVGCGYNAFPVGSEYADFPHMDDKQKDREIRKFRYIIHAEQNALTFRCQEIKPEERSMIF    351 - 420
VTKCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRE    421 - 490
NGVLRPVPQKEEQHQDKKLRLGIH                                                  491 - 514
//

Text Mined References (8)

PMID Year Title