Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.06
PubTator Score 3.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.5e-05
ductal carcinoma in situ 1745 1.8e-02
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 3.0
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 37 3.966 2.0
Choriocarcinoma 14 3.025 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
ductal carcinoma in situ -1.200 1.8e-02
osteosarcoma -2.319 2.5e-05

Gene RIF (2)

AA Sequence

MPIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKI      1 - 70
NRATLIRGLNSISRSSKSVAKLLHPQLACRLLELRDISGRLLREVNAPRQPLYNIQVRKGSLFEIISFPA     71 - 140
KTALTSIIYASYAALIYLAVCVNAVLKKVKNIFQEEESIRQNREESENCRKAFSEPVLSEPMFAEGEIKA    141 - 210
KPYRSLPEKPDISDYPKLLANKQSNNIQVLHSVFDQSAEMNEQI                              211 - 254
//

Text Mined References (7)

PMID Year Title