Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.06
PubTator Score 3.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 4.881447256085E-6
ductal carcinoma in situ 1745 0.0181372352535645
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 2.0
Disease Target Count Z-score Confidence
Sertoli cell-only syndrome 36 3.949 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.568 0.000
ductal carcinoma in situ -1.200 0.018

Synonym

Accession Q9BWV2 A8K8H3 Q4G122 Q86X33 Q8NA28
Symbols NYD-SP16

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
16963046 NYD-SP16 protein is component of sperm acrosome, which plays functional role in sperm capacitation and acrosome reaction and is consequently necessary for fertilization.
12493713 may play an important role in testicular development/spermatogenesis and may be an important factor in male infertility

AA Sequence

MPIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKI      1 - 70
NRATLIRGLNSISRSSKSVAKLLHPQLACRLLELRDISGRLLREVNAPRQPLYNIQVRKGSLFEIISFPA     71 - 140
KTALTSIIYASYAALIYLAVCVNAVLKKVKNIFQEEESIRQNREESENCRKAFSEPVLSEPMFAEGEIKA    141 - 210
KPYRSLPEKPDISDYPKLLANKQSNNIQVLHSVFDQSAEMNEQI                              211 - 254
//

Text Mined References (7)

PMID Year Title
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
16963046 2006 Human testicular protein NYD-SP16 is involved in sperm capacitation and the acrosome reaction.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12493713 2003 NYD-SP16, a novel gene associated with spermatogenesis of human testis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.