Property Summary

NCBI Gene PubMed Count 18
PubMed Score 46.42
PubTator Score 85.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.649 5.8e-06
astrocytoma 1.400 4.5e-16
atypical teratoid / rhabdoid tumor 1.500 2.9e-02
Breast cancer -1.200 2.4e-08
breast carcinoma -1.600 7.0e-44
ependymoma 1.800 9.5e-03
glioblastoma 1.300 1.9e-03
group 4 medulloblastoma -1.800 3.6e-03
interstitial lung disease 1.100 4.1e-02
intraductal papillary-mucinous adenoma (... -2.200 3.0e-04
intraductal papillary-mucinous carcinoma... -2.500 1.3e-04
intraductal papillary-mucinous neoplasm ... -2.100 4.8e-03
invasive ductal carcinoma -1.557 2.2e-04
lung carcinoma 1.100 2.8e-08
oligodendroglioma 1.200 2.5e-02
osteosarcoma 1.780 6.0e-04
ovarian cancer -2.200 3.0e-06
pancreatic cancer 1.500 3.7e-02
pediatric high grade glioma 1.100 9.3e-04
primary pancreatic ductal adenocarcinoma 1.729 1.6e-02
psoriasis -1.200 3.4e-57
subependymal giant cell astrocytoma 1.102 4.7e-02

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (8)

AA Sequence

MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRL      1 - 70
NGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLANLQDFKLDVQHVIEV     71 - 140
DEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRGNYLIMPSGNLQIVNASQEDEGMYKCAAYNPVTQEV    141 - 210
KTSGSSDRLRVRRSTAEAARIIYPPEAQTIIVTKGQSLILECVASGIPPPRVTWAKDGSSVTGYNKTRFL    211 - 280
LSNLLIDTTSEEDSGTYRCMADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKLTCEVRGNP    281 - 350
PPSVLWLRNAVPLISSQRLRLSRRALRVLSMGPEDEGVYQCMAENEVGSAHAVVQLRTSRPSITPRLWQD    351 - 420
AELATGTPPVSPSKLGNPEQMLRGQPALPRPPTSVGPASPQCPGEKGQGAPAEAPIILSSPRTSKTDSYE    421 - 490
LVWRPRHEGSGRAPILYYVVKHRKVTNSSDDWTISGIPANQHRLTLTRLDPGSLYEVEMAAYNCAGEGQT    491 - 560
AMVTFRTGRRPKPEIMASKEQQIQRDDPGASPQSSSQPDHGRLSPPEAPDRPTISTASETSVYVTWIPRG    561 - 630
NGGFPIQSFRVEYKKLKKVGDWILATSAIPPSRLSVEITGLEKGTSYKFRVRALNMLGESEPSAPSRPYV    631 - 700
VSGYSGRVYERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEG    701 - 770
DKYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKARKSSGQPGRLPPPTLAPPQPPLPETIERP    771 - 840
VGTGAMVARSSDLPYLIVGVVLGSIVLIIVTFIPFCLWRAWSKQKHTTDLGFPRSALPPSCPYTMVPLGG    841 - 910
LPGHQASGQPYLSGISGRACANGIHMNRGCPSAAVGYPGMKPQQHCPGELQQQSDTSSLLRQTHLGNGYD    911 - 980
PQSHQITRGPKSSPDEGSFLYTLPDDSTHQLLQPHHDCCQRQEQPAAVGQSGVRRAPDSPVLEAVWDPPF    981 - 1050
HSGPPCCLGLVPVEEVDSPDSCQVSGGDWCPQHPVGAYVGQEPGMQLSPGPLVRVSFETPPLTI         1051 - 1114
//

Text Mined References (22)

PMID Year Title