Property Summary

NCBI Gene PubMed Count 15
PubMed Score 16.36
PubTator Score 19.98

Knowledge Summary

Patent (3,925)

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.300 1.4e-02
psoriasis -1.200 6.2e-04
osteosarcoma -1.384 1.4e-03
medulloblastoma, large-cell -1.400 3.0e-04
tuberculosis 1.800 6.1e-09
primary pancreatic ductal adenocarcinoma 1.104 1.2e-02
intraductal papillary-mucinous adenoma (... 1.400 7.4e-03
posterior fossa group B ependymoma -1.100 1.2e-05
subependymal giant cell astrocytoma -1.167 3.9e-02
Pick disease 1.100 3.2e-02
ovarian cancer -1.300 3.9e-06

Synonym

Accession Q9BWU1 Q5JQZ7 Q5JR00 Q8TC78 Q9UPX2
Symbols CDK11
CDC2L6
bA346C16.3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (2)

Gary Johnson 302 Kinome profile via MIB/MS Technology
Jun Qin 39 Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (6)

PMID Text
26416749 Mediator-associated kinases CDK8 and CDK19 restrain increased activation of key super-enhancer-associated genes in acute myeloid leukaemia (AML) cells
26002960 Data suggest that, during neurogenesis, Mediator complex cyclin-dependent kinases (CDK8, CDK19) interact directly with PRC2 (polycomb repressive complex 2) subunit EZH2 (enhancer of zeste homolog 2), as well as SUZ12 (suppressor of zeste 12 homolog).
23749998 CDK8 and CDK19, individually interact with PRMT5 and WDR77, and their interactions with PRMT5 cause transcriptional repression of C/EBPbeta target genes.
22117896 Microarrays identified target genes for each CDK, and we selected six genes: two target genes of CDK8, two target genes of CDK19 and two genes that were targets for both.
20408451 plays a role in mechanisms of transcriptional regulation upon protein phosphorylation. (review)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALL      1 - 70
RELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIH     71 - 140
YLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARH    141 - 210
YTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQ    211 - 280
KDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQ    281 - 350
IPYPKREFLNEDDPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTG    351 - 420
AGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQS    421 - 490
SQYHPSHQAHRY                                                              491 - 502
//

Text Mined References (18)

PMID Year Title
26416749 2015 Mediator kinase inhibition further activates super-enhancer-associated genes in AML.
26002960 2015 Mediator complex cooperatively regulates transcription of retinoic acid target genes with Polycomb Repressive Complex 2 during neuronal differentiation.
23749998 2013 Mediator complex recruits epigenetic regulators via its two cyclin-dependent kinase subunits to repress transcription of immune response genes.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22117896 2011 Identification of target genes for the CDK subunits of the Mediator complex.
20408451 2010 [Mechanisms of transcriptional regulation upon protein phosphorylation by mediator complexes].
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19884882 2009 Cyclin-dependent kinases: a family portrait.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.