Property Summary

NCBI Gene PubMed Count 20
Grant Count 3
R01 Count 3
Funding $428,212.33
PubMed Score 3.65
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Alzheimer's disease 644 1.0

Expression

Synonym

Accession Q9BWU0 A6NJ39 Q4KMT1 Q4KMX0 Q7Z5Q9 Q9NVN2
Symbols HLC3

Gene

PDB

4H87  

Gene RIF (2)

PMID Text
25197798 Structural insights into the recognition of phosphopeptide by the FHA domain of kanadaptin
15764369 human kanadaptin did not interact with kidney anion exchanger 1 (kAE1) and had no effect on trafficking of kAE1 to the plasma membrane

AA Sequence

MLAPLRNAPGREGATSPSPPTDATGSLGEWDVDRNVKTEGWVSKERISKLHRLRMADILSQSETLASQDL      1 - 70
SGDFKKPALPVSPAARSKAPASSSSNPEEVQKEGPTALQDSNSGEPDIPPPQPDCGDFRSLQEEQSRPPT     71 - 140
AVSSPGGPARAPPYQEPPWGGPATAPYSLETLKGGTILGTRSLKGTSYCLFGRLSGCDVCLEHPSVSRYH    141 - 210
AVLQHRASGPDGECDSNGPGFYLYDLGSTHGTFLNKTRIPPRTYCRVHVGHVVRFGGSTRLFILQGPEED    211 - 280
REAESELTVTQLKELRKQQQILLEKKMLGEDSDEEEEMDTSERKINAGSQDDEMGCTWGMGEDAVEDDAE    281 - 350
ENPIVLEFQQEREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHS    351 - 420
GKKKEAMIQCSLEACRILDTLGLLRQEAVSRKRKAKNWEDEDFYDSDDDTFLDRTGLIEKKRLNRMKKAG    421 - 490
KIDEKPETFESLVAKLNDAERELSEISERLKASSQVLSESPSQDSLDAFMSEMKSGSTLDGVSRKKLHLR    491 - 560
TFELRKEQQRLKGLIKIVKPAEIPELKKTETQTTGAENKAKKLTLPLFGAMKGGSKFKLKTGTVGKLPPK    561 - 630
RPELPPTLMRMKDEPEVEEEEEEEEEEEKEKEEHEKKKLEDGSLSRPQPEIEPEAAVQEMRPPTDLTHFK    631 - 700
ETQTHENMSQLSEEEQNKDYQDCSKTTSLCAGPSASKNEYEKSRGELKKKKTPGPGKLPPTLSSKYPEDD    701 - 770
PDYCVWVPPEGQSGDGRTHLNDKYGY                                                771 - 796
//

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25197798 2014 Structural insights into the recognition of phosphopeptide by the FHA domain of kanadaptin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22159054 2011 A comprehensive genetic association study of Alzheimer disease in African Americans.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...