Property Summary

NCBI Gene PubMed Count 40
Grant Count 20
R01 Count 20
Funding $1,441,540.31
PubMed Score 25.19
PubTator Score 29.85

Knowledge Summary

Patent

No data available

Expression

Gene RIF (30)

PMID Text
26652023 Data indicate no association between caspase recruitment domain family, member 10 protein (CARD10) polymorphism rs6000782 and type 1 autoimmune hepatitis (AIH) in a Japanese population.
26526492 Findings indicate that CARMA3 may suppress the activation of the P38 MAPK signaling pathway to regulate invasion, migration and apoptosis of lung cancer cells by activating NF-small ka, CyrillicB (P65) in the nucleus.
26252200 miR-24 inhibited cell proliferation, invasion and epithelial to mesenchymal transition in bladder cancer cells by downregulation of CARMA3
25906011 A novel mechanism of CARMA3 in lung cancer stemness and metastasis through the negative regulation of NME2 was identified.
25541973 The study identified the DEP domain-containing protein DEPDC7 as cellular binding partner of CARMA2 and CARMA3 proteins.
24833094 CARMA3 regulates the ovarian cancer cell proliferation, cell cycle progression, and chemoresistance.
24633921 CARMA3 is overexpressed in pancreatic cancer and regulates malignant cell growth, invasion, and NF-kappaB signaling, which was dependent on its association with Bcl10.
24443255 CARMA3 is overexpressed in bladder cancer and regulates malignant cell growth and NF-kappaB signaling.
24018495 CARD10 may be involved in hepatic carcinogenesis associated with hepatitis C in Egyptian patients.
23893382 overexpression of CARMA3 in human glioma and its correlation with tumor grade.
More...

AA Sequence

MPGRAEAGEAEEEAGAGSGSEAEEDALWERIEGVRHRLARALNPAKLTPYLRQCRVIDEQDEEEVLSTYR      1 - 70
FPCRVNRTGRLMDILRCRGKRGYEAFLEALEFYYPEHFTLLTGQEPAQRCSMILDEEGPEGLTQFLMTEV     71 - 140
RRLREARKSQLQREQQLQARGRVLEEERAGLEQRLRDQQQAQERCQRLREDWEAGSLELLRLKDENYMIA    141 - 210
MRLAQLSEEKNSAVLRSRDLQLAVDQLKLKVSRLEEECALLRRARGPPPGAEEKEKEKEKEKEPDNVDLV    211 - 280
SELRAENQRLTASLRELQEGLQQEASRPGAPGSERILLDILEHDWREAQDSRQELCQKLHAVQGELQWAE    281 - 350
ELRDQYLQEMEDLRLKHRTLQKDCDLYKHRMATVLAQLEEIEKERDQAIQSRDRIQLQYSQSLIEKDQYR    351 - 420
KQVRGLEAERDELLTTLTSLEGTKALLEVQLQRAQGGTCLKACASSHSLCSNLSSTWSLSEFPSPLGGPE    421 - 490
ATGEAAVMGGPEPHNSEEATDSEKEINRLSILPFPPSAGSILRRQREEDPAPPKRSFSSMSDITGSVTLK    491 - 560
PWSPGLSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAIRVSGRSPPGGPEPQDKGPDGLSFYGDRWSG    561 - 630
AVVRRVLSGPGSARMEPREQRVEAAGLEGACLEAEAQQRTLLWNQGSTLPSLMDSKACQSFHEALEAWAK    631 - 700
GPGAEPFYIRANLTLPERADPHALCVKAQEILRLVDSAYKRRQEWFCTRVDPLTLRDLDRGTVPNYQRAQ    701 - 770
QLLEVQEKCLPSSRHRGPRSNLKKRALDQLRLVRPKPVGAPAGDSPDQLLLEPCAEPERSLRPYSLVRPL    771 - 840
LVSALRPVVLLPECLAPRLIRNLLDLPSSRLDFQVCPAESLSGEELCPSSAPGAPKAQPATPGLGSRIRA    841 - 910
IQESVGKKHCLLELGARGVRELVQNEIYPIVIHVEVTEKNVREVRGLLGRPGWRDSELLRQCRGSEQVLW    911 - 980
GLPCSWVQVPAHEWGHAEELAKVVRGRILQEQARLVWVECGSSRGCPSSSEA                      981 - 1032
//

Text Mined References (40)

PMID Year Title
26652023 2015 Lack of association between the CARD10 rs6000782 polymorphism and type 1 autoimmune hepatitis in a Japanese population.
26526492 2016 CARMA3 regulates the invasion, migration, and apoptosis of non-small cell lung cancer cells by activating NF-?B and suppressing the P38 MAPK signaling pathway.
26252200 2015 MicroRNA-24 upregulation inhibits proliferation, metastasis and induces apoptosis in bladder cancer cells by targeting CARMA3.
25906011 2015 CARMA3 Represses Metastasis Suppressor NME2 to Promote Lung Cancer Stemness and Metastasis.
25541973 2014 The Dishevelled, EGL-10 and pleckstrin (DEP) domain-containing protein DEPDC7 binds to CARMA2 and CARMA3 proteins, and regulates NF-?B activation.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
24833094 2014 Overexpression of CARMA3 is associated with advanced tumor stage, cell cycle progression, and cisplatin resistance in human epithelial ovarian cancer.
24768677 2014 Genome-wide association study identifies variants associated with autoimmune hepatitis type 1.
24633921 2014 CARMA3 is upregulated in human pancreatic carcinoma, and its depletion inhibits tumor proliferation, migration, and invasion.
24443255 2014 Clinical significance and biological roles of CARMA3 in human bladder carcinoma.
More...