Property Summary

NCBI Gene PubMed Count 7
PubMed Score 25.67
PubTator Score 13.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 1.964 5.9e-05
adult high grade glioma 1.100 1.1e-02
atypical teratoid / rhabdoid tumor 2.300 4.0e-06
Breast cancer 2.200 6.5e-08
Endometriosis 1.161 4.9e-02
glioblastoma 2.000 2.2e-06
group 3 medulloblastoma 2.400 1.2e-04
invasive ductal carcinoma 1.700 2.4e-03
lung adenocarcinoma 1.100 2.3e-07
medulloblastoma, large-cell 2.400 3.6e-06
non-small cell lung cancer 1.617 3.4e-19
osteosarcoma -2.374 1.4e-03
posterior fossa group A ependymoma 1.100 7.1e-03
primitive neuroectodermal tumor 2.700 1.0e-05

Gene RIF (4)

AA Sequence

MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNY      1 - 70
YWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAE     71 - 140
VEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID         141 - 205
//

Text Mined References (11)

PMID Year Title