Property Summary

NCBI Gene PubMed Count 7
PubMed Score 24.44
PubTator Score 13.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.36225612809461E-19
Breast cancer 3099 6.4552199812071E-8
sonic hedgehog group medulloblastoma 1482 2.74675054926111E-7
lung adenocarcinoma 2714 1.08941526544702E-6
glioblastoma 5572 2.22049150394712E-6
medulloblastoma, large-cell 6234 3.62662631650712E-6
atypical teratoid / rhabdoid tumor 4369 4.04323722014659E-6
primitive neuroectodermal tumor 3031 9.95467627024043E-6
adrenocortical carcinoma 1427 5.8557545895728E-5
pediatric high grade glioma 2712 4.10653333058077E-4
osteosarcoma 7933 0.00143954980043089
invasive ductal carcinoma 2950 0.00241822727187304
posterior fossa group A ependymoma 1511 0.00708847717603941
Endometriosis 535 0.0486573492294523

Expression

Synonym

Accession Q9BWT6 B2R5F9
Symbols GAJ

Gene

  Ortholog (13)

Gene RIF (4)

PMID Text
23675907 Data indicate that the positive expression of studied genes fertilization rate for GAPDHS positive subset was 66%, ACR - 71%, SPATA22 - 68%, MND1 - 70%, pregnancy rates were 8%, 6%, 18% and 36% respectively.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of meiotic nuclear divisions 1 homolog (MND1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16407260 Data suggest that the human TBPIP/Hop2-Mnd1 complex may ensure proper pairing between homologous chromosomes through its stimulation of strand exchange during meiosis.

AA Sequence

MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNY      1 - 70
YWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAE     71 - 140
VEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID         141 - 205
//

Text Mined References (11)

PMID Year Title
23675907 2013 Expression analysis of MND1/GAJ, SPATA22, GAPDHS and ACR genes in testicular biopsies from non-obstructive azoospermia (NOA) patients.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17639080 2007 Bipartite stimulatory action of the Hop2-Mnd1 complex on the Rad51 recombinase.
16407260 2006 Stimulation of DNA strand exchange by the human TBPIP/Hop2-Mnd1 complex.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...