Property Summary

NCBI Gene PubMed Count 14
PubMed Score 100.36
PubTator Score 9.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -1.500 1.9e-02
Breast cancer 3.400 2.9e-02
malignant mesothelioma 1.400 2.1e-04
medulloblastoma, large-cell 1.200 3.1e-04
osteosarcoma -1.250 2.0e-05
ovarian cancer -1.200 3.6e-04
sarcoidosis 1.200 1.1e-02

Gene RIF (4)

AA Sequence

MKEMSANTVLDSQRQQKHYGITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNL      1 - 70
VKEWISDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQD     71 - 140
GIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEIL    141 - 210
HLVPNKETFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSKWEW    211 - 280
PNPVLLKQPEESNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEI    281 - 350
LQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVESKIRVLVGNLERNEFITLAHVNPQSF    351 - 420
PGNKEHHKDNNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQANNINMLKEGMKIEATHVKKK    421 - 490
QLHHYLPAEILQKKKKQSLSDVNRSSGGLQSKRLSLDSSCLDSSRDTDNGTPFNSPASKSDSPSVGETER    491 - 560
NSAEPAAVIVEKPLSVPPAQGLSIPVIGAKVDSTVKTVSPPTVCTIPTVVGRNVIPRITTPHNPAQGQPH    561 - 630
LNGMSNITKTVTPKRSHSPSIDGTPKRLKDVEKFIRLESTFKDPRTAEERKRKSVDAIGGESMPIPTIDT    631 - 700
SRKKRLPSKELPDSSSPVPANNIRVIKNSIRLTLNR                                      701 - 736
//

Text Mined References (23)

PMID Year Title