Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.06
PubTator Score 11.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 7.8442031919889E-32
astrocytoma 1493 5.73567884437706E-16
oligodendroglioma 2849 1.4630332419409E-13
lung adenocarcinoma 2714 9.66313187181819E-13
psoriasis 6685 1.02212947370526E-11
atypical teratoid / rhabdoid tumor 4369 3.9519437715869E-11
posterior fossa group A ependymoma 1511 4.35686480632323E-11
glioblastoma 5572 2.47420595967977E-10
group 3 medulloblastoma 2254 1.03077645121011E-9
medulloblastoma, large-cell 6234 9.33907231262158E-9
pediatric high grade glioma 2712 4.08679215020114E-7
acute quadriplegic myopathy 1157 3.89257724044E-6
primitive neuroectodermal tumor 3031 4.37825725531721E-6
pancreatic cancer 2300 8.90546813955675E-6
tuberculosis 1563 1.02173784746568E-5
ovarian cancer 8492 4.00125048519908E-5
nasopharyngeal carcinoma 1056 7.59868984444702E-4
primary Sjogren syndrome 789 0.00139677704388048
mucosa-associated lymphoid tissue lymphoma 480 0.00772401964201853
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00788076364664963
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0096142104820334
ductal carcinoma in situ 1745 0.0117362195395934
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0155468404899592
adrenocortical carcinoma 1427 0.0403196662513094
interstitial cystitis 2299 0.0488168342585134
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 2.0
Disease Target Count Z-score Confidence
Mucinous cystadenocarcinoma 4 3.443 1.7

Expression

Synonym

Gene

  Ortholog (12)

Gene RIF (5)

PMID Text
26216346 Missense mutations in CDCA7 cause immunodeficiency-centromeric instability-facial anomalies syndrome type 3.
25385755 Data indicate that cell division cycle associated 7 protein (Cdca7) is strongly up-regulated in the hemogenic population during embryonic stem cell hematopoietic differentiation in a Notch-dependent manner.
24029427 The CDCA7 transcription factor regulates cell proliferation.
23166294 CDCA7 associates with MYC and this association is modulated in a phosphorylation-dependent manner.
16580749 JPO1/CDCA7 is a unique transcription regulator whose expression is activated by E2F1 as well as c-Myc.

AA Sequence

MDARRVPQKDLRVKKNLKKFRYVKLISMETSSSSDDSCDSFASDNFANTRLQSVREGCRTRSQCRHSGPL      1 - 70
RVAMKFPARSTRGATNKKAESRQPSENSVTDSNSDSEDESGMNFLEKRALNIKQNKAMLAKLMSELESFP     71 - 140
GSFRGRHPLPGSDSQSRRPRRRTFPGVASRRNPERRARPLTRSRSRILGSLDALPMEEEEEEDKYMLVRK    141 - 210
RKTVDGYMNEDDLPRSRRSRSSVTLPHIIRPVEEITEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDT    211 - 280
KTNCRNPDCWGVRGQFCGPCLRNRYGEEVRDALLDPNWHCPPCRGICNCSFCRQRDGRCATGVLVYLAKY    281 - 350
HGFGNVHAYLKSLKQEFEMQA                                                     351 - 371
//

Text Mined References (21)

PMID Year Title
26216346 2015 Mutations in CDCA7 and HELLS cause immunodeficiency-centromeric instability-facial anomalies syndrome.
25385755 2014 Identification of Cdca7 as a novel Notch transcriptional target involved in hematopoietic stem cell emergence.
24165912 2013 Genome-wide association study identifies 8 novel loci associated with blood pressure responses to interventions in Han Chinese.
24029427 2013 Chromosome 2q31.1 associates with ESRD in women with type 1 diabetes.
23974705 2013 A genome-wide association study of chronic otitis media with effusion and recurrent otitis media identifies a novel susceptibility locus on chromosome 2.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23166294 2013 The MYC-associated protein CDCA7 is phosphorylated by AKT to regulate MYC-dependent apoptosis and transformation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...