Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.06
PubTator Score 11.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

Gene RIF (5)

PMID Text
26216346 Missense mutations in CDCA7 cause immunodeficiency-centromeric instability-facial anomalies syndrome type 3.
25385755 Data indicate that cell division cycle associated 7 protein (Cdca7) is strongly up-regulated in the hemogenic population during embryonic stem cell hematopoietic differentiation in a Notch-dependent manner.
24029427 The CDCA7 transcription factor regulates cell proliferation.
23166294 CDCA7 associates with MYC and this association is modulated in a phosphorylation-dependent manner.
16580749 JPO1/CDCA7 is a unique transcription regulator whose expression is activated by E2F1 as well as c-Myc.

AA Sequence

MDARRVPQKDLRVKKNLKKFRYVKLISMETSSSSDDSCDSFASDNFANTRLQSVREGCRTRSQCRHSGPL      1 - 70
RVAMKFPARSTRGATNKKAESRQPSENSVTDSNSDSEDESGMNFLEKRALNIKQNKAMLAKLMSELESFP     71 - 140
GSFRGRHPLPGSDSQSRRPRRRTFPGVASRRNPERRARPLTRSRSRILGSLDALPMEEEEEEDKYMLVRK    141 - 210
RKTVDGYMNEDDLPRSRRSRSSVTLPHIIRPVEEITEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDT    211 - 280
KTNCRNPDCWGVRGQFCGPCLRNRYGEEVRDALLDPNWHCPPCRGICNCSFCRQRDGRCATGVLVYLAKY    281 - 350
HGFGNVHAYLKSLKQEFEMQA                                                     351 - 371
//

Text Mined References (21)

PMID Year Title
26216346 2015 Mutations in CDCA7 and HELLS cause immunodeficiency-centromeric instability-facial anomalies syndrome.
25385755 2014 Identification of Cdca7 as a novel Notch transcriptional target involved in hematopoietic stem cell emergence.
24165912 2013 Genome-wide association study identifies 8 novel loci associated with blood pressure responses to interventions in Han Chinese.
24029427 2013 Chromosome 2q31.1 associates with ESRD in women with type 1 diabetes.
23974705 2013 A genome-wide association study of chronic otitis media with effusion and recurrent otitis media identifies a novel susceptibility locus on chromosome 2.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23166294 2013 The MYC-associated protein CDCA7 is phosphorylated by AKT to regulate MYC-dependent apoptosis and transformation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...