Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.93
PubTator Score 7.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 7.3e-07
osteosarcoma 7950 3.2e-04
intraductal papillary-mucinous neoplasm (IPMN) 3291 2.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.300 2.5e-03
osteosarcoma -1.303 3.2e-04
tuberculosis 1.200 7.3e-07

Gene RIF (6)

AA Sequence

MRTLFNLLWLALACSPVHTTLSKSDAKKAASKTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSA      1 - 70
KARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPVWLQLKRRGREMFEVTGLHDVDQGWMRAVRKH     71 - 140
AKGLHIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVVQVAKNQHFDGFVVEVWNQLLSQKRVGLIHMLT    141 - 210
HLAEALHQARLLALLVIPPAITPGTDQLGMFTHKEFEQLAPVLDGFSLMTYDYSTAHQPGPNAPLSWVRA    211 - 280
CVQVLDPKSKWRSKILLGLNFYGMDYATSKDAREPVVGARYIQTLKDHRPRMVWDSQASEHFFEYKKSRS    281 - 350
GRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL                               351 - 393
//

Text Mined References (20)

PMID Year Title