Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.90
PubTator Score 7.10

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.303 0.000
tuberculosis 1.200 0.000
intraductal papillary-mucinous neoplasm ... -1.300 0.002

Synonym

Accession Q9BWS9 B3KWB0 Q8NBM9 Q96CZ3 Q96S93 Q96SK0 Q9BY52
Symbols GL008
SICLP
SI-CLP

Gene

PANTHER Protein Class (2)

PDB

3BXW  

Gene RIF (5)

PMID Text
26733160 This review comprehensively analyzes recent data about expression pattern, and involvement of human YKL-40, YKL-39 and SI-CLP in cancer. [review]
24470346 stabilin-1-interacting chitinase-like protein functions as a regulator of the inflammatory response in rheumatoid arthritis by macrophages.
20724479 Structure of human stabilin-1 interacting chitinase-like protein (SI-CLP) reveals a saccharide-binding cleft with lower sugar-binding selectivity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19275751 The crystals of SI-CLP belong to the space group P3(2)21 with unit cell parameters a=b=99.79 A, c=250.53 A, alpha=beta=90 degrees, gamma=120 degrees.

AA Sequence

MRTLFNLLWLALACSPVHTTLSKSDAKKAASKTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSA      1 - 70
KARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPVWLQLKRRGREMFEVTGLHDVDQGWMRAVRKH     71 - 140
AKGLHIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVVQVAKNQHFDGFVVEVWNQLLSQKRVGLIHMLT    141 - 210
HLAEALHQARLLALLVIPPAITPGTDQLGMFTHKEFEQLAPVLDGFSLMTYDYSTAHQPGPNAPLSWVRA    211 - 280
CVQVLDPKSKWRSKILLGLNFYGMDYATSKDAREPVVGARYIQTLKDHRPRMVWDSQASEHFFEYKKSRS    281 - 350
GRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL                               351 - 393
//

Text Mined References (20)

PMID Year Title
26733160 2016 Role of chitinase-like proteins in cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25241909 2014 Genetic susceptibility for chronic bronchitis in chronic obstructive pulmonary disease.
24470346 2014 Human secreted stabilin-1-interacting chitinase-like protein aggravates the inflammation associated with rheumatoid arthritis and is a potential macrophage inflammatory regulator in rodents.
23558346 2013 New paralogues and revised time line in the expansion of the vertebrate GH18 family.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20724479 2010 Structure of human stabilin-1 interacting chitinase-like protein (SI-CLP) reveals a saccharide-binding cleft with lower sugar-binding selectivity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
More...