Property Summary

NCBI Gene PubMed Count 36
PubMed Score 234.70
PubTator Score 21.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.394 3.3e-02
active ulcerative colitis 1.207 2.9e-02
adult high grade glioma -2.100 6.0e-07
aldosterone-producing adenoma -1.378 2.6e-02
astrocytoma -1.100 7.1e-14
Astrocytoma, Pilocytic -1.300 4.0e-07
atypical teratoid / rhabdoid tumor -2.600 5.0e-10
cutaneous lupus erythematosus 1.600 2.8e-02
ependymoma -1.400 3.6e-02
glioblastoma -2.100 9.9e-12
group 3 medulloblastoma -2.600 4.8e-07
interstitial cystitis 1.200 1.3e-02
medulloblastoma, large-cell -2.300 1.3e-05
non diabetic and post-ischemic heart fai... -1.300 1.2e-03
oligodendroglioma -1.100 2.7e-10
Pick disease -1.100 6.7e-03
pituitary cancer 1.800 7.6e-07
primitive neuroectodermal tumor -1.500 7.1e-04
subependymal giant cell astrocytoma -2.526 1.2e-02
type II diabetes mellitus and post-ische... -1.200 1.2e-02

Gene RIF (24)

AA Sequence

MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDP      1 - 70
SSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGW     71 - 140
YWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVT    141 - 210
VFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNR    211 - 280
RHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE                                      281 - 316
//

Text Mined References (39)

PMID Year Title