Property Summary

NCBI Gene PubMed Count 32
Grant Count 11
Funding $4,865,914.95
PubMed Score 214.67
PubTator Score 21.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (21)

PMID Text
26398169 The interaction of TRIM21 and LFG was analyzed by co-immunoprecipitation. To examine changes in regulatory processes, western blot analyses, real-time PCR, activity of apoptotic process and flow cytometric analyses were carried out.
25922107 There are significant differences in the associations of the FAIM2 promoter methylation with sedentary behaviour and physical activity between obese and lean children.
25764978 These results suggest that the TMBIM family has comparable functions in the maintenance of intracellular Ca(2) homeostasis in a wide variety of tissues
25735388 Low KRT13 mRNA expression is associated with oral squamous cell carcinoma.
25696115 Methylation levels of the FAIM2 promoter are significantly associated with obesity and are independently associated with dyslipidaemia and its components in Chinese children.
25069766 Results indicated that FAIM2 beta-isoform is strongly expressed in breast tumour tissues. Fas sensitivity was reduced in the MCF10A breast cells expressing the FAIM2 beta-isoform.
24621099 This study highlighted the importance of two candidate genes, SH2B1 and FAIM2, in the risk of overweight/obesity.
24393375 A polymorphism in FAIM2 is associated with higher myocardial infarction risk in type-2 diabetes mellitus subjects.
24335530 Faim2 is physiologically expressed in brain in bacterial meningitis.
23924573 The rs7138803 variant of FAIM2 was found to exert no effect on obesity in a Chinese Han population.
More...

AA Sequence

MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDP      1 - 70
SSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGW     71 - 140
YWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVT    141 - 210
VFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNR    211 - 280
RHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE                                      281 - 316
//

Text Mined References (35)

PMID Year Title
26398169 2015 TRIM21, a negative modulator of LFG in breast carcinoma MDA-MB-231 cells in vitro.
25922107 2015 Influence of lifestyle on the FAIM2 promoter methylation between obese and lean children: a cohort study.
25764978 2015 The transmembrane Bax inhibitor motif (TMBIM) containing protein family: Tissue expression, intracellular localization and effects on the ER CA²?-filling state.
25735388 2015 KRT13, FAIM2 and CYP2W1 mRNA expression in oral squamous cell carcinoma patients with risk habits.
25696115 2015 Promoter methylation of fas apoptotic inhibitory molecule 2 gene is associated with obesity and dyslipidaemia in Chinese children.
25069766 2014 Role of lifeguard ?-isoform in the development of breast cancer.
24621099 2014 Meta-analyses between 18 candidate genetic markers and overweight/obesity.
24393375 2014 Novel association of the obesity risk-allele near Fas Apoptotic Inhibitory Molecule 2 (FAIM2) gene with heart rate and study of its effects on myocardial infarction in diabetic participants of the PREDIMED trial.
24335530 2014 Modulation of hippocampal neuroplasticity by Fas/CD95 regulatory protein 2 (Faim2) in the course of bacterial meningitis.
23924573 2013 Common rs7138803 variant of FAIM2 and obesity in Han Chinese.
More...