Property Summary

NCBI Gene PubMed Count 22
PubMed Score 25.30
PubTator Score 7.83

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (9)

Gene RIF (17)

AA Sequence

MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDM      1 - 70
GDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIK     71 - 140
NAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEK    141 - 210
EGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM             211 - 271
//

Text Mined References (29)

PMID Year Title