Property Summary

NCBI Gene PubMed Count 20
PubMed Score 18.77
PubTator Score 7.83

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BWP8 A1IGE4 A1IGE5 A1IGE6 A7VJJ2 A7VJJ3 A7VJJ4 A7VJJ5 B2R9M5 B4E1G0 J3KQY9 Q5CZ85 Q7Z6N1
Symbols 3MC2
CLK1
CL-K1-I
CL-K1-II
CL-K1-IIa
CL-K1-IIb

Gene

PANTHER Protein Class (1)

PDB

4YLI   4YMD  

Gene RIF (15)

PMID Text
26173080 identify collectin CL-LK as a novel soluble C-type lectin able to bind M. tuberculosis, and characterize mycobacterial mannose-capped lipoarabinomannan as a primary ligand for CL-LK
26154564 Data indicate differences in the plasma concentrations of collectin liver 1 and collectin kidney 1, M-ficolin and H-ficol in systemic lupus erythematosus (SLE) patients compared to a group of healthy controls.
25912189 the sugar specificity of CL-K1 was established.
25710878 promoter polymorphism COLEC11-9570C>T (rs3820897) was associated with decreased levels of CL-K1.
24474086 These results suggest that specific diseases may affect CL-K1 synthesis in an organ dependent manner and that elevated plasma CL-K1 levels are associated with the presence of DIC.
24174618 Most plasma CL-K1 was found in complex with CL-L1 in a ratio suggesting a heteromeric subunit of 1 CL-L1 & 2 CL-K1 polypeptides. It associated with MASPs 1, 2 & 3. On binding mannan or DNA in the presence of MASP-2, the complex deposited C4b.
23954398 Data suggest that collectin 11 (CL-11), e.g. via complement, may play a role in response to particles and surfaces presenting extracellular DNA, such as apopototic cells.
23220946 collectin-11 associates with all the known MBL-associated serine proteases (MASP-1, MASP-2 and MASP-3) as well as the lectin complement pathway regulator MAP-1.
21893516 Data show that the concentration of collectin kidney 1 (CL-K1, COLEC11) in plasma was 0.34 +/- 0.13 microg/ml and that in mannan-binding lectin (MBL) was 1.72 +/- 1.51 microg/ml.
21258343 these findings demonstrate a role for complement pathway factors in fundamental developmental processes and in the etiology of 3MC syndrome.
More...

AA Sequence

MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDM      1 - 70
GDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIK     71 - 140
NAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEK    141 - 210
EGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM             211 - 271
//

Text Mined References (26)

PMID Year Title
26173080 2015 Collectin CL-LK Is a Novel Soluble Pattern Recognition Receptor for Mycobacterium tuberculosis.
26154564 2015 Collectin liver 1 and collectin kidney 1 and other complement-associated pattern recognition molecules in systemic lupus erythematosus.
25912189 2015 Molecular basis of sugar recognition by collectin-K1 and the effects of mutations associated with 3MC syndrome.
25710878 2015 Genetic variation of COLEC10 and COLEC11 and association with serum levels of collectin liver 1 (CL-L1) and collectin kidney 1 (CL-K1).
24474086 2014 Elevated plasma CL-K1 level is associated with a risk of developing disseminated intravascular coagulation (DIC).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24174618 2013 Heteromeric complexes of native collectin kidney 1 and collectin liver 1 are found in the circulation with MASPs and activate the complement system.
23954398 2013 Characterization of the interaction between collectin 11 (CL-11, CL-K1) and nucleic acids.
23220946 2013 Collectin-11/MASP complex formation triggers activation of the lectin complement pathway--the fifth lectin pathway initiation complex.
21893516 2012 Comparison of human blood concentrations of collectin kidney 1 and mannan-binding lectin.
More...