Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.22
PubTator Score 3.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.329 0.016
non-small cell lung cancer 1.030 0.000
group 3 medulloblastoma 1.300 0.004
psoriasis 1.200 0.000
spina bifida -1.045 0.046
Breast cancer 1.800 0.000
ovarian cancer 1.900 0.000

Gene RIF (1)

PMID Text
23167344 our findings indicate that NICE-3 may contribute to human hepatocellular carcinoma by promoting cell proliferation.

AA Sequence

MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQ      1 - 70
DIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLR     71 - 140
NTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATAVKARIGSSQRHHQSAAKDLTQ    141 - 210
SPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL                               211 - 253
//

Text Mined References (11)

PMID Year Title
23167344 2012 Up-regulation of NICE-3 as a novel EDC gene could contribute to human hepatocellular carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230159 2001 Identification of human epidermal differentiation complex (EDC)-encoded genes by subtractive hybridization of entire YACs to a gridded keratinocyte cDNA library.
More...