Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.39
PubTator Score 3.13

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 1.800 2.1e-18
group 3 medulloblastoma 1.300 3.8e-03
non-small cell lung cancer 1.030 8.4e-08
ovarian cancer 1.900 1.3e-04
pancreatic ductal adenocarcinoma liver m... -1.329 1.6e-02
psoriasis 1.200 1.9e-14
spina bifida -1.045 4.6e-02

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQ      1 - 70
DIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLR     71 - 140
NTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATAVKARIGSSQRHHQSAAKDLTQ    141 - 210
SPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL                               211 - 253
//

Text Mined References (11)

PMID Year Title