Property Summary

NCBI Gene PubMed Count 10
Grant Count 46
R01 Count 26
Funding $13,320,089.66
PubMed Score 56.68
PubTator Score 1299.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.400 0.000
glioblastoma 1.700 0.000
atypical teratoid / rhabdoid tumor 1.600 0.000
medulloblastoma 1.100 0.000
medulloblastoma, large-cell 1.100 0.000
lung cancer -1.100 0.028
pediatric high grade glioma 1.500 0.000

Gene RIF (2)

PMID Text
24610814 Interacts with Ku and enhances efficiency of DNA double strand break ligation in vitro
17043244 Characterizes the hamster ortholog and suggests that it may modulate the ability of the proteasome to degrade retroviral cores upon cellular infection.

AA Sequence

METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAARLPATRTVYCMNEAEIVDVALGILI      1 - 70
ESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPE     71 - 140
EEEEEDVLKYVREIFFS                                                         141 - 157
//

Text Mined References (15)

PMID Year Title
27063109 2016 The Ku-binding motif is a conserved module for recruitment and stimulation of non-homologous end-joining proteins.
25416956 2014 A proteome-scale map of the human interactome network.
24610814 2014 A human short open reading frame (sORF)-encoded polypeptide that stimulates DNA end joining.
23377288 2014 Developmental changes in the transcriptome of human cerebral cortex tissue: long noncoding RNA transcripts.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
17043244 2006 Isolation, characterization, and genetic complementation of a cellular mutant resistant to retroviral infection.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...