Property Summary

NCBI Gene PubMed Count 11
PubMed Score 54.43
PubTator Score 1299.48

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.500 5.1e-06
atypical teratoid / rhabdoid tumor 1.600 4.7e-06
ependymoma 1.400 7.6e-15
glioblastoma 1.400 8.7e-10
group 3 medulloblastoma 1.100 4.4e-03
lung cancer -1.100 2.8e-02
medulloblastoma, large-cell 1.100 1.4e-04

Gene RIF (2)

AA Sequence

METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAARLPATRTVYCMNEAEIVDVALGILI      1 - 70
ESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPE     71 - 140
EEEEEDVLKYVREIFFS                                                         141 - 157
//

Text Mined References (16)

PMID Year Title