Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.600 1.2e-03
glioblastoma 1.200 1.3e-03
non primary Sjogren syndrome sicca 1.200 3.9e-02
ovarian cancer 1.600 2.0e-04
pancreatic ductal adenocarcinoma liver m... -1.039 2.4e-02

AA Sequence

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLME      1 - 70
KMLQPCGPPADKPEEN                                                           71 - 86
//

Text Mined References (19)

PMID Year Title