Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.200 0.001
pancreatic ductal adenocarcinoma liver m... -1.039 0.024
diabetes mellitus -1.600 0.001
non primary Sjogren syndrome sicca 1.200 0.039
ovarian cancer 1.600 0.000

Synonym

Accession Q9BWJ5 B2R568 Q7RTV1 SF3b5
Symbols Ysf3
SF3b10

Gene

AA Sequence

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLME      1 - 70
KMLQPCGPPADKPEEN                                                           71 - 86
//

Text Mined References (17)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146077 2004 The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...