Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
Funding $273,188.34
PubMed Score 3.51
PubTator Score 3.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.400 0.000

Synonym

Accession Q9BWH2 B2R7W5 D3DWY5 Q8NHX8 Q9H2I6
Symbols DC44
HCC3
HCBP6
PD03104

Gene

 GO Process (1)

Gene RIF (1)

PMID Text
25855506 our results provide new evidence that miR-122-regulated HCBP6 functions as a sensor protein to maintain intrahepatocyte Triglyceride levels.

AA Sequence

METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLF      1 - 70
GQESGPSAEKYSVATQLFIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYIKVDWQRVEKDMK     71 - 140
KAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLLGMAS                         141 - 189
//

Text Mined References (18)

PMID Year Title
25855506 2015 HCBP6 Modulates Triglyceride Homeostasis in Hepatocytes Via the SREBP1c/FASN Pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16381901 2006 The LIFEdb database in 2006.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
More...