Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.86
PubTator Score 3.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8519 5.6e-07

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.400 5.6e-07

Synonym

Accession Q9BWH2 B2R7W5 D3DWY5 Q8NHX8 Q9H2I6
Symbols DC44
HCC3
HCBP6
PD03104

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (1)

AA Sequence

METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLF      1 - 70
GQESGPSAEKYSVATQLFIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYIKVDWQRVEKDMK     71 - 140
KAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLLGMAS                         141 - 189
//

Text Mined References (18)

PMID Year Title