Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.86
PubTator Score 3.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 5.6e-07

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.400 5.6e-07

Gene RIF (1)

AA Sequence

METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLF      1 - 70
GQESGPSAEKYSVATQLFIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYIKVDWQRVEKDMK     71 - 140
KAKEQLKIRKSNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLLGMAS                         141 - 189
//

Text Mined References (18)

PMID Year Title