Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.81
PubTator Score 2.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 5.8e-06
non primary Sjogren syndrome sicca 891 3.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Lennox-Gastaut syndrome 34 3.684 1.8
Dystonia 164 3.09 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 3.3e-02
ovarian cancer 1.300 5.8e-06

AA Sequence

MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLS      1 - 70
SLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPS     71 - 140
VSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWV    141 - 210
KDENVEFDSDEEEPPDLPLD                                                      211 - 230
//

Text Mined References (18)

PMID Year Title