Property Summary

NCBI Gene PubMed Count 12
Grant Count 9
R01 Count 9
Funding $1,146,992.51
PubMed Score 4.75
PubTator Score 2.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 0.033
ovarian cancer 1.300 0.000

AA Sequence

MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLS      1 - 70
SLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPS     71 - 140
VSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWV    141 - 210
KDENVEFDSDEEEPPDLPLD                                                      211 - 230
//

Text Mined References (17)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17656373 2007 Evidence for a direct role of the disease modifier SCNM1 in splicing.
More...