Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.13
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 2.19125450237987E-9
ovarian cancer 8492 3.44583944913999E-5
osteosarcoma 7933 2.26668048774391E-4
glioblastoma 5572 2.46035213763028E-4
medulloblastoma, large-cell 6234 0.00115550562889701
medulloblastoma 1524 0.00209145488945818
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00491930148468839

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.315 0.000
glioblastoma -1.200 0.000
medulloblastoma -1.100 0.002
medulloblastoma, large-cell -1.400 0.001
pancreatic ductal adenocarcinoma liver m... 1.013 0.005
tuberculosis 1.800 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q9BWG4 Q9BWW5
Symbols

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MYAKGGKGSAVPSDSQAREKLALYVYEYLLHIGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDL      1 - 70
YCAAPDRREACEHSGEAKAFQDYSAAAAPSPVMGSMAPGDTMAAGSMAAGFFQGPPGSQPSPHNPNAPMM     71 - 140
GPHGQPFMSPRFPGGPRPTLRMPSQPPAGLPGSQPLLPGAMEPSPRAQGHPSMGGPMQRVTPPRGMASVG    141 - 210
PQSYGGGMRPPPNSLAGPGLPAMNMGPGVRGPWASPSGNSIPYSSSSPGSYTGPPGGGGPPGTPIMPSPG    211 - 280
DSTNSSENMYTIMNPIGQGAGRANFPLGPGPEGPMAAMSAMEPHHVNGSLGSGDMDGLPKSSPGAVAGLS    281 - 350
NAPGTPRDDGEMAAAGTFLHPFPSESYSPGMTMSV                                       351 - 385
//

Text Mined References (19)

PMID Year Title
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...