Property Summary

NCBI Gene PubMed Count 37
PubMed Score 51.94
PubTator Score 84.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

 IMPC Phenotype (1)

Gene RIF (20)

AA Sequence

MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEAS      1 - 70
KNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKR     71 - 140
MHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLY    141 - 210
YNNAYGALDAYYKRCRAARSYEAVAAAAASVYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDRHLLPTS    211 - 280
GAAATAAAAAAAAAAVTAASTSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAARNSLYDMARY    281 - 350
EREQYADRARYSAF                                                            351 - 364
//

Text Mined References (48)

PMID Year Title