Property Summary

NCBI Gene PubMed Count 33
Grant Count 23
R01 Count 14
Funding $2,375,655.66
PubMed Score 47.53
PubTator Score 84.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
26506517 Loss of RBM4 expression is associated with colorectal cancer.
25414336 The results indicate that the alanine-rich C-terminal domain, in conjunction with its conjoined RNA-binding domain(s), differentially influences the subnuclear localization and biogenesis of RBM4.
25203323 RBM4 is a tumor suppressor with therapeutic potential and clinical values as a prognostic factor.
25140042 Up-regulation of RBM4 is associated with breast cancer.
24389249 we propose the emerging role of RBM4 in regulating the adipocyte-specific splicing events and transcription cascade, which subsequently facilitate the development and function of brown adipocyte-like cells.
23897118 role in negative feed-forward loop that disrupts inflammattory cytokine translation following Toll-like receptor 4 response
23527094 RBM4 homologs exert different effects on 5' splice site utilization and exon selection, and exhibit different subnuclear localization patterns.
21518792 RBM4 may synergize its effect on muscle cell-specific alternative splicing by down-regulating PTB expression and antagonizing the activity of PTB in exon selection
19801630 Data show that RBM4 interacts directly with Ago2 during muscle cell differentiation and may recruit Ago2 to suppress translation of target mRNAs.
19416963 The alternative splicing imbalance of CoAA and RBM4, because of loss of their common enhancer in cancer, may deregulate stem/progenitor cell differentiation
More...

AA Sequence

MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEAS      1 - 70
KNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKR     71 - 140
MHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLY    141 - 210
YNNAYGALDAYYKRCRAARSYEAVAAAAASVYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDRHLLPTS    211 - 280
GAAATAAAAAAAAAAVTAASTSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAARNSLYDMARY    281 - 350
EREQYADRARYSAF                                                            351 - 364
//

Text Mined References (43)

PMID Year Title
26506517 2015 The impact of RNA binding motif protein 4-regulated splicing cascade on the progression and metabolism of colorectal cancer cells.
25414336 2014 Alanine repeats influence protein localization in splicing speckles and paraspeckles.
25203323 2014 The splicing factor RBM4 controls apoptosis, proliferation, and migration to suppress tumor progression.
25140042 2014 Elevated SRPK1 lessens apoptosis in breast cancer cells through RBM4-regulated splicing events.
24389249 2014 Emerging role for RNA binding motif protein 4 in the development of brown adipocytes.
23897118 2013 MicroRNA-146a and RBM4 form a negative feed-forward loop that disrupts cytokine mRNA translation following TLR4 responses in human THP-1 monocytes.
23527094 2013 Phylogenetic and molecular characterization of the splicing factor RBM4.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...