Property Summary

NCBI Gene PubMed Count 19
PubMed Score 35.75
PubTator Score 11.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
aldosterone-producing adenoma -1.184 4.6e-02
astrocytic glioma 1.300 1.9e-02
atypical teratoid / rhabdoid tumor 2.100 1.6e-03
ependymoma 1.400 1.5e-02
glioblastoma 2.100 6.3e-03
group 4 medulloblastoma 1.900 6.2e-03
lung cancer 1.400 1.3e-03
medulloblastoma, large-cell 2.200 5.1e-06
oligodendroglioma 1.400 3.2e-03
osteosarcoma -1.350 2.3e-04
ovarian cancer 1.300 2.4e-04
pediatric high grade glioma 1.500 1.3e-02

Gene RIF (6)

AA Sequence

MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWV      1 - 70
ALWLHTRRCQARLPLPCPECGRRFRHAPFLALHRQVHAAATPDLGFACHLCGQSFRGWVALVLHLRAHSA     71 - 140
AKRPIACPKCERRFWRRKQLRAHLRRCHPPAPEARPFICGNCGRSFAQWDQLVAHKRVHVAEALEEAAAK    141 - 210
ALGPRPRGRPAVTAPRPGGDAVDRPFQCACCGKRFRHKPNLIAHRRVHTGERPHQCPECGKRFTNKPYLT    211 - 280
SHRRIHTGEKPYPCKECGRRFRHKPNLLSHSKIHKRSEGSAQAAPGPGSPQLPAGPQESAAEPTPAVPLK    281 - 350
PAQEPPPGAPPEHPQDPIEAPPSLYSCDDCGRSFRLERFLRAHQRQHTGERPFTCAECGKNFGKKTHLVA    351 - 420
HSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPDRPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYVCP    421 - 490
DCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEERLLA    491 - 560
HQKKHDV                                                                   561 - 567
//

Text Mined References (25)

PMID Year Title