Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 1.0e-05
glioblastoma 5792 1.4e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Colon adenocarcinoma 2 3.148 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.0e-05
glioblastoma 1.300 1.4e-05

AA Sequence

MDGRVQLMKALLAGPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLIT      1 - 70
RLTGPALQWVIPYIRKESPLLNDYRGFLAEMKRVFGWEEDEDF                                71 - 113
//

Text Mined References (10)

PMID Year Title