Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.27
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.400 2.0e-05
sonic hedgehog group medulloblastoma -1.400 4.0e-05

Synonym

Accession Q9BWC9 B3KUF9 D3K183 Q99786
Symbols ZNF581
HSU79303

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALE      1 - 70
RNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLS     71 - 140
GASEEGSASERRRQKQKGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDR    141 - 210
NTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKR    211 - 280
//

Text Mined References (11)

PMID Year Title