Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.70
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.400 0.000
sonic hedgehog group medulloblastoma -1.400 0.000

Gene RIF (1)

PMID Text
20159018 CCDC106 promotes the degradation of p53 protein and inhibits its transactivity.

AA Sequence

MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALE      1 - 70
RNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLS     71 - 140
GASEEGSASERRRQKQKGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDR    141 - 210
NTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKR    211 - 280
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20159018 2010 Identification and characterization of the novel protein CCDC106 that interacts with p53 and promotes its degradation.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.