Property Summary

NCBI Gene PubMed Count 13
PubMed Score 47.90
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 21 1 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 2.8e-08
malignant mesothelioma 3232 4.4e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Myositis 30 4.473 2.2
Nonspecific interstitial pneumonia 4 3.484 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 1.100 2.8e-08
malignant mesothelioma 1.100 4.4e-06

Gene RIF (4)

AA Sequence

MALYQRWRCLRLQGLQACRLHTAVVSTPPRWLAERLGLFEELWAAQVKRLASMAQKEPRTIKISLPGGQK      1 - 70
IDAVAWNTTPYQLARQISSTLADTAVAAQVNGEPYDLERPLETDSDLRFLTFDSPEGKAVFWHSSTHVLG     71 - 140
AAAEQFLGAVLCRGPSTEYGFYHDFFLGKERTIRGSELPVLERICQELTAAARPFRRLEASRDQLRQLFK    141 - 210
DNPFKLHLIEEKVTGPTATVYGCGTLVDLCQGPHLRHTGQIGGLKLLSNSSSLWRSSGAPETLQRVSGIS    211 - 280
FPTTELLRVWEAWREEAELRDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYAHRGFSE    281 - 350
VKTPTLFSTKLWEQSGHWEHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRP    351 - 420
RSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSF    421 - 490
RLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGRPHQCGTIQLD    491 - 560
FQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPFQVVVIPVGSEQEEYAK    561 - 630
EAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAV    631 - 700
QRLVELQNTRVPNAEEIF                                                        701 - 718
//

Text Mined References (16)

PMID Year Title