Property Summary

NCBI Gene PubMed Count 14
Grant Count 6
R01 Count 4
Funding $338,083.34
PubMed Score 20.75
PubTator Score 15.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma -1.316 0.000
ovarian cancer 2.100 0.000
pancreatic cancer -1.500 0.001
dermatomyositis 1.100 0.001

Synonym

Accession Q9BW91 Q8NBN1 Q8NCB9 Q8NG25
Symbols NUDT10

Gene

PANTHER Protein Class (1)

PDB

1Q33   1QVJ  

Gene RIF (5)

PMID Text
19574167 NUDT9 may be involved in the regulation of the menstrual cycle and may be related to the proliferation of glandular cells in the human endometrium
16860484 parallel enzymic characterization of the specific ADP-ribose pyrophosphatase from human placenta and a recombinant NUDT9 protein expressed from a cDNA clone was carried out
12948489 Data report the crystal structures of NUDT9 in the presence and in the absence of the reaction product ribose 5'-phosphate.
12427752 analysis of the human NUDT9 gene and its potential alternative transcripts along with detailed studies of the enzymatic properties and cell biological behavior of human NUDT9 protein
11825615 Hydrolyses ADP-ribose to AMP and ribose-5-phosphate

AA Sequence

MAGRLLGKALAAVSLSLALASVTIRSSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKENSHNKARTSPY      1 - 70
PGSKVERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNFSPKFNEKDGHVERKSKNGLY     71 - 140
EIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDSSGNKIMHPVSGKHILQFVAIKRKDCGEW    141 - 210
AIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNTDNAWM    211 - 280
ETEAVNYHDETGEIMDNLMLEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHAL    281 - 350
//

Text Mined References (18)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19574167 2009 Differential expression of NUDT9 at different phases of the menstrual cycle and in different components of normal and neoplastic human endometrium.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16860484 2006 The specific, submicromolar-Km ADP-ribose pyrophosphatase purified from human placenta is enzymically indistinguishable from recombinant NUDT9 protein, including a selectivity for Mn2+ as activating cation and increase in Km for ADP-ribose, both elicited by H2O2.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...