Property Summary

NCBI Gene PubMed Count 14
PubMed Score 21.20
PubTator Score 15.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
dermatomyositis 1.100 7.3e-04
ovarian cancer -1.500 2.5e-06
pancreatic cancer -1.500 6.7e-04
primary pancreatic ductal adenocarcinoma -1.316 3.1e-04

Gene RIF (5)

AA Sequence

MAGRLLGKALAAVSLSLALASVTIRSSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKENSHNKARTSPY      1 - 70
PGSKVERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNFSPKFNEKDGHVERKSKNGLY     71 - 140
EIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDSSGNKIMHPVSGKHILQFVAIKRKDCGEW    141 - 210
AIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNTDNAWM    211 - 280
ETEAVNYHDETGEIMDNLMLEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHAL    281 - 350
//

Text Mined References (18)

PMID Year Title