Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.74
PubTator Score 0.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Liver neoplasms 109
Precancerous Conditions 69

Expression

Synonym

Accession Q9BW72
Symbols RCF1b

Gene

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRG      1 - 70
NSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP                                       71 - 106
//

Text Mined References (6)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22342701 2012 Rcf1 mediates cytochrome oxidase assembly and respirasome formation, revealing heterogeneity of the enzyme complex.
21856340 2011 The survival effect of mitochondrial Higd-1a is associated with suppression of cytochrome C release and prevention of caspase activation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.