Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.89
PubTator Score 0.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Liver neoplasms 130 0.0 0.0
Precancerous Conditions 80 0.0 0.0

Expression

Gene RIF (1)

AA Sequence

MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRG      1 - 70
NSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP                                       71 - 106
//

Text Mined References (6)

PMID Year Title