Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.52
PubTator Score 2.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 3.7e-05
psoriasis 6694 3.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
DiGeorge syndrome 47 4.724 2.4
Velocardiofacial syndrome 46 3.916 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.300 3.7e-05
psoriasis 1.800 3.0e-04

Gene RIF (2)

AA Sequence

MAREKEMQEFTRSFFRGRPDLSTLTHSIVRRRYLAHSGRSHLEPEEKQALKRLVEEELLKMQVDEAASRE      1 - 70
DKLDLTKKGKRPPTPCSDPERKRFRFNSESESGSEASSPDYFGPPAKNGVAAEVSPAKEENPRRASKAVE     71 - 140
ESSDEERQRDLPAQRGEESSEEEEKGYKGKTRKKPVVKKQAPGKASVSRKQAREESEESEAEPVQRTAKK    141 - 210
VEGNKGTKSLKESEQESEEEILAQKKEQREEEVEEEEKEEDEEKGDWKPRTRSNGRRKSAREERSCKQKS    211 - 280
QAKRLLGDSDSEEEQKEAASSGDDSGRDREPPVQRKSEDRTQLKGGKRLSGSSEDEEDSGKGEPTAKGSR    281 - 350
KMARLGSTSGEESDLEREVSDSEAGGGPQGERKNRSSKKSSRKGRTRSSSSSSDGSPEAKGGKAGSGRRG    351 - 420
EDHPAVMRLKRYIRACGAHRNYKKLLGSCCSHKERLSILRAELEALGMKGTPSLGKCRALKEQREEAAEV    421 - 490
ASLDVANIISGSGRPRRRTAWNPLGEAAPPGELYRRTLDSDEERPRPAPPDWSHMRGIISSDGESN        491 - 556
//

Text Mined References (24)

PMID Year Title