Property Summary

NCBI Gene PubMed Count 11
PubMed Score 60.51
PubTator Score 30.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.200 4.9e-02
atypical teratoid / rhabdoid tumor -1.300 8.4e-09
glioblastoma -1.200 1.7e-04

Protein-protein Interaction (6)

Gene RIF (3)

AA Sequence

MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSS      1 - 70
PASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTW     71 - 140
PTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHR    141 - 210
AL                                                                        211 - 212
//

Text Mined References (19)

PMID Year Title