Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.61
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
ductal carcinoma in situ -1.200 6.2e-03
fibroadenoma -1.100 3.6e-02
intraductal papillary-mucinous adenoma (... -1.100 4.1e-02
invasive ductal carcinoma -1.500 1.2e-03
medulloblastoma, large-cell -1.600 4.5e-04
oligodendroglioma -1.200 4.5e-02
osteosarcoma -1.705 5.9e-05
ovarian cancer -2.400 3.0e-10

Gene RIF (3)

AA Sequence

MNLAEICDNAKKGREYALLGNYDSSMVYYQGVMQQIQRHCQSVRDPAIKGKWQQVRQELLEEYEQVKSIV      1 - 70
STLESFKIDKPPDFPVSCQDEPFRDPAVWPPPVPAEHRAPPQIRRPNREVRPLRKEMAGVGARGPVGRAH     71 - 140
PISKSEKPSTSRDKDYRARGRDDKGRKNMQDGASDGEMPKFDGAGYDKDLVEALERDIVSRNPSIHWDDI    141 - 210
ADLEEAKKLLREAVVLPMWMPDFFKGIRRPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSK    211 - 280
YRGESEKLVRLLFEMARFYAPTTIFIDEIDSICSRRGTSDEHEASRRVKSELLIQMDGVGGALENDDPSK    281 - 350
MVMVLAATNFPWDIDEALRRRLEKRIYIPLPTAKGRAELLKINLREVELDPDIQLEDIAEKIEGYSGADI    351 - 420
TNVCRDASLMAMRRRINGLSPEEIRALSKEELQMPVTKGDFELALKKIAKSVSAADLEKYEKWMVEFGSA    421 - 490
//

Text Mined References (19)

PMID Year Title