Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.48
PubTator Score 2.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
oligodendroglioma -1.200 0.045
osteosarcoma -1.705 0.000
medulloblastoma, large-cell -1.600 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.041
fibroadenoma -1.100 0.036
ductal carcinoma in situ -1.200 0.006
invasive ductal carcinoma -1.500 0.001
ovarian cancer -2.400 0.000

Gene RIF (3)

PMID Text
24913027 KATNAL1 gene sequence variants are not associated with azoospermia.
24664804 microdeletion 13q12.3 represents a novel clinically recognizable condition and that the microtubule severing gene KATNAL1 and the chromatin-associated gene HMGB1 are candidate genes for intellectual disability inherited in an autosomal dominant pattern.
20519956 KL1-mediated microtubule severing is utilized to generate microtubule seeds within the poles and loss of this activity alters the normal balance of motor-generated forces that determine spindle length.

AA Sequence

MNLAEICDNAKKGREYALLGNYDSSMVYYQGVMQQIQRHCQSVRDPAIKGKWQQVRQELLEEYEQVKSIV      1 - 70
STLESFKIDKPPDFPVSCQDEPFRDPAVWPPPVPAEHRAPPQIRRPNREVRPLRKEMAGVGARGPVGRAH     71 - 140
PISKSEKPSTSRDKDYRARGRDDKGRKNMQDGASDGEMPKFDGAGYDKDLVEALERDIVSRNPSIHWDDI    141 - 210
ADLEEAKKLLREAVVLPMWMPDFFKGIRRPWKGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSK    211 - 280
YRGESEKLVRLLFEMARFYAPTTIFIDEIDSICSRRGTSDEHEASRRVKSELLIQMDGVGGALENDDPSK    281 - 350
MVMVLAATNFPWDIDEALRRRLEKRIYIPLPTAKGRAELLKINLREVELDPDIQLEDIAEKIEGYSGADI    351 - 420
TNVCRDASLMAMRRRINGLSPEEIRALSKEELQMPVTKGDFELALKKIAKSVSAADLEKYEKWMVEFGSA    421 - 490
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24913027 2014 Lack of association of KATNAL1 gene sequence variants and azoospermia in humans.
24664804 2014 A newly recognized 13q12.3 microdeletion syndrome characterized by intellectual disability, microcephaly, and eczema/atopic dermatitis encompassing the HMGB1 and KATNAL1 genes.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
22654668 2012 KATNAL1 regulation of sertoli cell microtubule dynamics is essential for spermiogenesis and male fertility.
21897333 2011 Genes linked to energy metabolism and immunoregulatory mechanisms are associated with subcutaneous adipose tissue distribution in HIV-infected men.
20519956 2010 KL1 is a novel microtubule severing enzyme that regulates mitotic spindle architecture.
19302785 2009 Ab initio protein modelling reveals novel human MIT domains.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...