Property Summary

NCBI Gene PubMed Count 11
Grant Count 34
R01 Count 17
Funding $4,861,772.06
PubMed Score 4.88
PubTator Score 238.12

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
19633818 TPPP3 played a crucial role in cell mitosis by regulating centrosomes amplification and/or spindles translocation processes.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.

AA Sequence

MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVI      1 - 70
NYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD     71 - 140
ESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK                                      141 - 176
//

Text Mined References (12)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19633818 2010 Depletion of tubulin polymerization promoting protein family member 3 suppresses HeLa cell proliferation.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17105200 2006 Tubulin polymerization promoting proteins (TPPPs): members of a new family with distinct structures and functions.
15590652 2005 p25alpha Stimulates alpha-synuclein aggregation and is co-localized with aggregated alpha-synuclein in alpha-synucleinopathies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
More...