Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.88
PubTator Score 238.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BW30 Q49AH9 Q9Y326 Q9Y6H0
Symbols p20
CGI-38
TPPP/p20
p25gamma

Gene

PDB

2JRF  

  Ortholog (9)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (2)

PMID Text
19633818 TPPP3 played a crucial role in cell mitosis by regulating centrosomes amplification and/or spindles translocation processes.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.

AA Sequence

MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVI      1 - 70
NYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD     71 - 140
ESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK                                      141 - 176
//

Text Mined References (12)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19633818 2010 Depletion of tubulin polymerization promoting protein family member 3 suppresses HeLa cell proliferation.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17105200 2006 Tubulin polymerization promoting proteins (TPPPs): members of a new family with distinct structures and functions.
15590652 2005 p25alpha Stimulates alpha-synuclein aggregation and is co-localized with aggregated alpha-synuclein in alpha-synucleinopathies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
More...