Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.35
PubTator Score 238.12

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVI      1 - 70
NYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD     71 - 140
ESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK                                      141 - 176
//

Text Mined References (12)

PMID Year Title