Property Summary

NCBI Gene PubMed Count 20
PubMed Score 17.93
PubTator Score 10.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Pick disease 1894 5.8e-05
lung cancer 4740 1.1e-04
ovarian cancer 8520 2.5e-04
dermatomyositis 966 7.6e-04
osteosarcoma 7950 1.2e-03
group 3 medulloblastoma 4104 3.1e-03
gastric carcinoma 807 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Vulvovaginal candidiasis 5 4.084 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.100 7.6e-04
gastric carcinoma 1.100 1.7e-02
group 3 medulloblastoma 1.700 3.1e-03
lung cancer 1.400 1.1e-04
osteosarcoma -1.210 1.2e-03
ovarian cancer -1.100 2.5e-04
Pick disease -1.400 5.8e-05

 MGI Phenotype (1)

Gene RIF (8)

AA Sequence

MEELDGEPTVTLIPGVNSKKNQMYFDWGPGEMLVCETSFNKKEKSEMVPSCPFIYIIRKDVDVYSQILRK      1 - 70
LFNESHGIFLGLQRIDEELTGKSRKSQLVRVSKNYRSVIRACMEEMHQVAIAAKDPANGRQFSSQVSILS     71 - 140
AMELIWNLCEILFIEVAPAGPLLLHLLDWVRLHVCEVDSLSADVLGSENPSKHDSFWNLVTILVLQGRLD    141 - 210
EARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQHWHEECERYLQDSTFATSPHL    211 - 280
ESLLKIMLGDEAALLEQKELLSNWYHFLVTRLLYSNPTVKPIDLHYYAQSSLDLFLGGESSPEPLDNILL    281 - 350
AAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLYFGSNMREFLLLEYASGLFAHPSLWQLG    351 - 420
VDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWS    421 - 490
IRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLL    491 - 560
LSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETT    561 - 630
KVEMLRLSLARNLARAIIREGSLEGS                                                631 - 656
//

Text Mined References (29)

PMID Year Title