Property Summary

NCBI Gene PubMed Count 20
Grant Count 4
R01 Count 4
Funding $449,983.34
PubMed Score 15.87
PubTator Score 10.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.210 0.001
group 3 medulloblastoma 1.700 0.003
lung cancer 1.400 0.000
Pick disease -1.400 0.000
gastric carcinoma 1.100 0.017
ovarian cancer 2.200 0.000
dermatomyositis 1.100 0.001

Synonym

Accession Q9BW27 B4DMQ3 B4DPW1 Q8NDI4 Q9H9U1
Symbols Nup75
FROUNT

Gene

PANTHER Protein Class (1)

PDB

5A9Q  

 MGI Term (1)

Gene RIF (8)

PMID Text
25283965 results support a model of CCR2 equilibrium: chemokine binding changes the conformational equilibrium of CCR2 toward the active state, and Pro-C switches its binding partner from the membrane to FROUNT
24128342 Residues on the hydrophobic side are completely conserved among FROUNT-binding receptors.
19841162 FROUNT binds to the C-terminal domain of CCR5 in addition to that of CCR2.
19576787 Data show that the C Terminus of Nup120 Directly Binds Nup145C and Nup85.
19454010 Interaction of HIV-1 Tat with Nup85 in T-cells is identified by a proteomic strategy based on affinity chromatography
18187620 Knockdown of nucleoporin 85kDa (NUP85) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17395051 The CCL2/CCR2 pathway via FROUNT may influence the clinical severity of CHF.
14767062 Interaction of HIV-1 Tat with Nup85 in T-cells is identified by a proteomic strategy based on affinity chromatography

AA Sequence

MEELDGEPTVTLIPGVNSKKNQMYFDWGPGEMLVCETSFNKKEKSEMVPSCPFIYIIRKDVDVYSQILRK      1 - 70
LFNESHGIFLGLQRIDEELTGKSRKSQLVRVSKNYRSVIRACMEEMHQVAIAAKDPANGRQFSSQVSILS     71 - 140
AMELIWNLCEILFIEVAPAGPLLLHLLDWVRLHVCEVDSLSADVLGSENPSKHDSFWNLVTILVLQGRLD    141 - 210
EARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQHWHEECERYLQDSTFATSPHL    211 - 280
ESLLKIMLGDEAALLEQKELLSNWYHFLVTRLLYSNPTVKPIDLHYYAQSSLDLFLGGESSPEPLDNILL    281 - 350
AAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLYFGSNMREFLLLEYASGLFAHPSLWQLG    351 - 420
VDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWS    421 - 490
IRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLL    491 - 560
LSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETT    561 - 630
KVEMLRLSLARNLARAIIREGSLEGS                                                631 - 656
//

Text Mined References (29)

PMID Year Title
27194810 2016 Systematic Protein-Protein Interaction Analysis Reveals Intersubcomplex Contacts in the Nuclear Pore Complex.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26391640 2015 Crystal structure of human nuclear pore complex component NUP43.
25283965 2014 Structural basis for the binding of the membrane-proximal C-terminal region of chemokine receptor CCR2 with the cytosolic regulator FROUNT.
24927568 2014 Probing nuclear pore complex architecture with proximity-dependent biotinylation.
24315095 2013 Integrated structural analysis of the human nuclear pore complex scaffold.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24128342 2014 Identification of a binding element for the cytoplasmic regulator FROUNT in the membrane-proximal C-terminal region of chemokine receptors CCR2 and CCR5.
21269460 2011 Initial characterization of the human central proteome.
21193048 2011 Expression and purification of human FROUNT, a common cytosolic regulator of CCR2 and CCR5.
More...