Property Summary

Ligand Count 11
NCBI Gene PubMed Count 27
PubMed Score 91.30
PubTator Score 44.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 1.4e-09
glioblastoma 1.100 1.9e-05
group 3 medulloblastoma 2.000 6.4e-06
lung cancer 1.800 4.0e-04
malignant mesothelioma 2.400 5.9e-07
medulloblastoma, large-cell 1.800 1.5e-05
non-small cell lung cancer 1.075 1.5e-19
ovarian cancer 1.200 2.1e-08
pediatric high grade glioma 1.100 1.6e-04
primitive neuroectodermal tumor 1.700 3.1e-06
psoriasis 1.300 1.9e-63

Gene RIF (19)

AA Sequence

MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVP      1 - 70
SLTTVPQTQGQTTAQKVSKKTGPRCSTAIATGLKNQKPVPAVPVQKSGTSGVPPMAGGKKPSKRPAWDLK     71 - 140
GQLCDLNAELKRCRERTQTLDQENQQLQDQLRDAQQQVKALGTERTTLEGHLAKVQAQAEQGQQELKNLR    141 - 210
ACVLELEERLSTQEGLVQELQKKQVELQEERRGLMSQLEEKERRLQTSEAALSSSQAEVASLRQETVAQA    211 - 280
ALLTEREERLHGLEMERRRLHNQLQELKGNIRVFCRVRPVLPGEPTPPPGLLLFPSGPGGPSDPPTRLSL    281 - 350
SRSDERRGTLSGAPAPPTRHDFSFDRVFPPGSGQDEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTM    351 - 420
EGGPGGDPQLEGLIPRALRHLFSVAQELSGQGWTYSFVASYVEIYNETVRDLLATGTRKGQGGECEIRRA    421 - 490
GPGSEELTVTNARYVPVSCEKEVDALLHLARQNRAVARTAQNERSSRSHSVFQLQISGEHSSRGLQCGAP    491 - 560
LSLVDLAGSERLDPGLALGPGERERLRETQAINSSLSTLGLVIMALSNKESHVPYRNSKLTYLLQNSLGG    561 - 630
SAKMLMFVNISPLEENVSESLNSLRFASKVNQCVIGTAQANRK                               631 - 673
//

Text Mined References (31)

PMID Year Title