Property Summary

NCBI Gene PubMed Count 25
Grant Count 22
R01 Count 21
Funding $3,285,570.58
PubMed Score 78.36
PubTator Score 44.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 2.400 0.000
glioblastoma 1.600 0.000
medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 1.700 0.000
non-small cell lung cancer 1.075 0.000
lung cancer 1.800 0.000
pediatric high grade glioma 1.100 0.000
ovarian cancer 1.200 0.000
psoriasis 1.300 0.000

Gene RIF (16)

PMID Text
26992853 Association of KIFC1 gene expression and centrosome amplification with high-grade serous ovarian carcinoma.
26987684 stabilization of the centrosome-spindle pole interface by the CEP215-HSET complex could promote survival of cancer cells containing supernumerary centrosomes.
26177331 KIFC1 silencing significantly reduces breast cancer cell viability.
25788277 Data provides the first evidence of centrosome clustering-independent activities of HSET that fuel tumor progression.
25028599 Our data underscore KIFC1 as a putative biomarker that predicts worse prognosis, poor overall survival and may serve as a potential marker of onset of metastatic dissemination in ovarian cancer patients.
24857844 We show that some are new substrates of the anaphase-promoting complex/cyclosome and validate KIFC1 and RacGAP1/Cyk4 as two such targets involved respectively in timely mitotic spindle disassembly and cell spreading
24039245 Study demonstrates microtubule tip-tracking of human kinesin-14 HSET and show that EB1 is sufficient to induce this dynamic microtubule end localization.
23318213 we suggest that KIFC1 plays an essential role for bipolar MTOC formation and maintaining chromosomal stability in the mitosis .
22946058 Acentrosomal spindle assembly mechanisms are hyperactive in cancer cells and promote HSET.
22201025 A case-control analysis was carried out by comparing the genotype distribution of six KIFC1 single-nucleotide polymorphisms between 93 aspirin exacerbated respiratory disease cases and 96 aspirin-tolerant asthma controls in a Korean population
More...

AA Sequence

MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVP      1 - 70
SLTTVPQTQGQTTAQKVSKKTGPRCSTAIATGLKNQKPVPAVPVQKSGTSGVPPMAGGKKPSKRPAWDLK     71 - 140
GQLCDLNAELKRCRERTQTLDQENQQLQDQLRDAQQQVKALGTERTTLEGHLAKVQAQAEQGQQELKNLR    141 - 210
ACVLELEERLSTQEGLVQELQKKQVELQEERRGLMSQLEEKERRLQTSEAALSSSQAEVASLRQETVAQA    211 - 280
ALLTEREERLHGLEMERRRLHNQLQELKGNIRVFCRVRPVLPGEPTPPPGLLLFPSGPGGPSDPPTRLSL    281 - 350
SRSDERRGTLSGAPAPPTRHDFSFDRVFPPGSGQDEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTM    351 - 420
EGGPGGDPQLEGLIPRALRHLFSVAQELSGQGWTYSFVASYVEIYNETVRDLLATGTRKGQGGECEIRRA    421 - 490
GPGSEELTVTNARYVPVSCEKEVDALLHLARQNRAVARTAQNERSSRSHSVFQLQISGEHSSRGLQCGAP    491 - 560
LSLVDLAGSERLDPGLALGPGERERLRETQAINSSLSTLGLVIMALSNKESHVPYRNSKLTYLLQNSLGG    561 - 630
SAKMLMFVNISPLEENVSESLNSLRFASKVNQCVIGTAQANRK                               631 - 673
//

Text Mined References (29)

PMID Year Title
26992853 2016 A centrosome clustering protein, KIFC1, predicts aggressive disease course in serous ovarian adenocarcinomas.
26987684 2016 A CEP215-HSET complex links centrosomes with spindle poles and drives centrosome clustering in cancer.
26177331 2015 KIFC1 is a novel potential therapeutic target for breast cancer.
25788277 2015 HSET overexpression fuels tumor progression via centrosome clustering-independent mechanisms in breast cancer patients.
25028599 2014 KIFCI, a novel putative prognostic biomarker for ovarian adenocarcinomas: delineating protein interaction networks and signaling circuitries.
24857844 2014 Using in vivo biotinylated ubiquitin to describe a mitotic exit ubiquitome from human cells.
24039245 2013 The human kinesin-14 HSET tracks the tips of growing microtubules in vitro.
23318213 2013 KIFC1 is essential for bipolar spindle formation and genomic stability in the primary human fibroblast IMR-90 cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22946058 2012 Acentrosomal spindle organization renders cancer cells dependent on the kinesin HSET.
More...