Property Summary

NCBI Gene PubMed Count 17
Grant Count 34
R01 Count 25
Funding $7,944,697.33
PubMed Score 83.08
PubTator Score 23.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.001
ovarian cancer 1.100 0.000

Gene RIF (3)

PMID Text
25554682 The results suggest that MXD3 is important for survival of Reh preB ALL cells, possibly as an anti-apoptotic factor.
25053245 Acute MXD3 activation results in a transient increase in DAOY cell proliferation while persistent activation of MXD3 results in an overall decrease in cell number, suggesting that the time course of MXD3 expression dictates the cellular outcome.
22808009 Increased level and/or duration of MXD3 expression ultimately reduces cell numbers via increased cell death and cell cycle arrest in medulloblastoma cells.

AA Sequence

MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRSVHNELEKRRR      1 - 70
AQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLKERLRSKQQSLQRQLEQLRGL     71 - 140
AGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGFVAGQEHSYSHGGGAWL        141 - 206
//

Text Mined References (19)

PMID Year Title
25554682 2015 Loss of MXD3 induces apoptosis of Reh human precursor B acute lymphoblastic leukemia cells.
25416956 2014 A proteome-scale map of the human interactome network.
25053245 2014 MXD3 regulation of DAOY cell proliferation dictated by time course of activation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22808009 2012 Role of MXD3 in proliferation of DAOY human medulloblastoma cells.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
18235219 2008 From cerebellar proliferation to tumorigenesis: new insights into the role of Mad3.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17893326 2007 A novel role of the Mad family member Mad3 in cerebellar granule neuron precursor proliferation.
16908182 2006 The MAX-interacting transcription factor network.
More...