Property Summary

NCBI Gene PubMed Count 11
PubMed Score 39.80
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Breast cancer -1.600 1.7e-03
esophageal adenocarcinoma -1.600 3.2e-02
gastric carcinoma -1.400 4.6e-02
interstitial cystitis -2.100 1.9e-02
intraductal papillary-mucinous adenoma (... 3.000 1.1e-04
intraductal papillary-mucinous carcinoma... 2.100 4.2e-03
intraductal papillary-mucinous neoplasm ... 2.600 4.1e-03
lung adenocarcinoma -1.100 4.7e-04
lung cancer -3.500 3.2e-06
lung carcinoma -1.500 1.6e-11
nasopharyngeal carcinoma -2.900 9.8e-09
non-small cell lung cancer -3.027 1.1e-16
ovarian cancer 1.900 2.1e-04
pancreatic cancer 1.600 7.4e-05
psoriasis 1.100 2.3e-03
spina bifida -2.359 4.3e-02

Gene RIF (1)

AA Sequence

MPERELWPAGTGSEPVTRVGSCDSMMSSTSTRSGSSDSSYDFLSTEEKECLLFLEETIGSLDTEADSGLS      1 - 70
TDESEPATTPRGFRALPITQPTPRGGPEETITQQGRTPRTVTESSSSHPPEPQGLGLRSGSYSLPRNIHI     71 - 140
ARSQNFRKSTTQASSHNPGEPGRLAPEPEKEQVSQSSQPRQAPASPQEAALDLDVVLIPPPEAFRDTQPE    141 - 210
QCREASLPEGPGQQGHTPQLHTPSSSQEREQTPSEAMSQKAKETVSTRYTQPQPPPAGLPQNARAEDAPL    211 - 280
SSGEDPNSRLAPLTTPKPRKLPPNIVLKSSRSSFHSDPQHWLSRHTEAAPGDSGLISCSLQEQRKARKEA    281 - 350
LEKLGLPQDQDEPGLHLSKPTSSIRPKETRAQHLSPAPGLAQPAAPAQASAAIPAAGKALAQAPAPAPGP    351 - 420
AQGPLPMKSPAPGNVAASKSMPISIPKAPRANSALTPPKPESGLTLQESNTPGLRQMNFKSNTLERSGVG    421 - 490
LSSYLSTEKDASPKTSTSLGKGSFLDKISPSVLRNSRPRPASLGTGKDFAGIQVGKLADLEQEQSSKRLS    491 - 560
YQGQSRDKLPRPPCVSVKISPKGVPNEHRREALKKLGLLKE                                 561 - 601
//

Text Mined References (16)

PMID Year Title