Property Summary

NCBI Gene PubMed Count 7
PubMed Score 163.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

AA Sequence

MGSQHSAAARPSSCRRKQEDDRDGLLAEREQEEAIAQFPYVEFTGRDSITCLTCQGTGYIPTEQVNELVA      1 - 70
LIPHSDQRLRPQRTKQYVLLSILLCLLASGLVVFFLFPHSVLVDDDGIKVVKVTFNKQDSLVILTIMATL     71 - 140
KIRNSNFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGGPFSYVYFFCTVPEIL    141 - 210
VHNIVIFMRTSVKISYIGLMTQSSLETHHYVDCGGNSTAI                                  211 - 250
//

Text Mined References (9)

PMID Year Title