Small integral membrane protein 2

Property Summary

NCBI Gene PubMed Count	2
PubMed Score	0.00

Knowledge Summary

Patent

No data available

TINX Plot

Disease (1)

JensenLab Experiment DistiLD

Disease	Target Count	Z-score	Confidence
Amyotrophic lateral sclerosis	451	0.0	1.1

Expression

Specificity
Differential

Testis 18,518

Small Intestine - Terminal Ileum 17,954

Artery - Tibial 17,631

Pituitary 18,147

Prostate 18,213

Kidney - Cortex 17,329

Spleen 17,614

Ovary 17,971

Brain - Cortex 18,039

Brain - Frontal Cortex (BA9) 18,069

Adrenal Gland 18,071

Adipose - Visceral (Omentum) 17,937

Artery - Coronary 17,949

Uterus 17,618

Brain - Hypothalamus 18,169

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Nucleus accumbens (basal ganglia... 18,024

Pancreas 18,123

Colon - Transverse 17,825

Breast - Mammary Tissue 18,103

Adipose - Subcutaneous 18,110

Artery - Aorta 17,896

Colon - Sigmoid 18,089

Minor Salivary Gland 18,005

Vagina 17,834

Cells - Transformed fibroblasts 17,577

Esophagus - Mucosa 18,076

Brain - Caudate (basal ganglia) 18,001

Stomach 17,879

Heart - Atrial Appendage 17,896

Skin - Not Sun Exposed (Suprapubic) 18,081

Liver 18,071

Brain - Spinal cord (cervical c-1) 17,973

Brain - Amygdala 18,006

Skin - Sun Exposed (Lower leg) 17,968

Esophagus - Gastroesophageal Junction 18,000

Brain - Substantia nigra 17,981

Brain - Cerebellum 17,983

Heart - Left Ventricle 18,006

Lung 18,057

Brain - Hippocampus 18,011

Brain - Cerebellar Hemisphere 18,015

Brain - Putamen (basal ganglia) 17,863

Esophagus - Muscularis 18,017

Thyroid 18,024

Nerve - Tibial 18,007

Muscle - Skeletal 17,778

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

breast 16,063

cerebral cortex 16,630

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

ovary 15,408

pancreas 14,070

placenta 15,937

prostate 16,460

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Uterine cervix 418

Synonym

Accession	Q9BVW6 Q5SZS7
Symbols	C13orf44

Gene

SMIM2

Ortholog (1)

Species	Source	Disease
Macaque	OMA EggNOG Inparanoid

UniProt Keyword (5)

Complete proteome 20,231

Reference proteome 20,231

Membrane 7,361

Transmembrane 5,228

Transmembrane helix 5,207

GO Component (1)

integral component of membrane 3,665

Compartment GO Term (5)

Integral component of membrane 5,330

Intrinsic component of membrane 5,457

Membrane 8,530

Membrane part 6,553

cellular_component 18,320

GWAS Trait (3)

Schizophrenia 533

Homeostasis model assessment of insulin ... 14

Fasting insulin (dietary factor interact... 13

HCA RNA Cell Line (49)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

CACO-2 15,436

See all...

AA Sequence

MEAGERIDASQLPHRVLETRGHAISILFGFWTSFICDTYIVLAWISKIKGSPDVSASSDEPYARIQQSRR      1 - 70
QCHAEEDQSQVPEAG                                                            71 - 85
//

Text Mined References (4)

Summary
Details

	PMID	Year	Title