Property Summary

NCBI Gene PubMed Count 20
PubMed Score 28.36
PubTator Score 16.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer 1.600 7.4e-06
colon cancer 1.200 4.5e-02
ependymoma 1.100 1.4e-05
glioblastoma 1.300 4.4e-05
group 3 medulloblastoma 1.600 1.7e-03
lung cancer 2.700 3.7e-04
nasopharyngeal carcinoma 1.200 7.3e-04
non-small cell lung cancer 1.092 7.1e-12
ovarian cancer 1.600 4.8e-05
pediatric high grade glioma 1.300 1.9e-04
pituitary cancer 1.100 2.3e-03
ulcerative colitis 1.100 3.7e-04

 GO Function (1)

Gene RIF (12)

AA Sequence

MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGAPVRVPPKRTVKRNIPKLDAQ      1 - 70
RLISERGLPALRHVFDKAKFKGKGHEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCL     71 - 140
KRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELSRSLTEEQQQRIERNKQLA    141 - 210
LERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIANTLNEEETLLD    211 - 280
QSFKNVQQQLDATSRNITEAR                                                     281 - 301
//

Text Mined References (28)

PMID Year Title