Property Summary

NCBI Gene PubMed Count 19
Grant Count 43
R01 Count 31
Funding $2,636,054.83
PubMed Score 27.94
PubTator Score 16.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
posterior fossa group B ependymoma 1.200 0.000
glioblastoma 1.300 0.000
group 3 medulloblastoma 1.600 0.002
non-small cell lung cancer 1.092 0.000
lung cancer 2.700 0.000
colon cancer 1.200 0.045
pediatric high grade glioma 1.300 0.000
nasopharyngeal carcinoma 1.200 0.001
ulcerative colitis 1.100 0.000
ovarian cancer 1.600 0.000
Breast cancer 1.600 0.000
pituitary cancer 1.100 0.002

 GO Function (1)

Gene RIF (11)

PMID Text
26004086 TIPIN is important for the maintenance of DNA replication and represents a potential treatment target for the worst prognosis associated breast cancers, such as Triple-negative breast cancer.
23511638 Tim-Tipin complex (or Tim alone) is able to associate with DNA polymerase epsilon bound to a 40-/80-mer DNA ligand.
23359676 Tim-Tipin complex might play a role in coupling DNA unwinding and DNA synthesis by directly affecting the catalytic activities of replication fork proteins.
21490103 We now show that cellular DNA replication fork pausing and protection factors Timeless (Tim) and Tipin (Timeless-interacting protein) accumulate at OriP during S phase of the cell cycle.
20233725 RPA-covered ssDNA not only supports recruitment and activation of ATR but also, through Tipin and Claspin, it plays an important role in the action of ATR on its critical downstream target Chk1
20174623 Observational study of gene-disease association. (HuGE Navigator)
20124417 The results suggest that Timeless-Tipin functions as a replication fork stabilizer that couples DNA replication with sister chromatid cohesion established at replication forks.
17296725 These findings indicate that the Tim-Tipin complex mediates the UV-induced intra-S checkpoint, Tim is needed to maintain DNA replication fork movement, Tipin interacts with RPA on DNA.
17141802 TIM and Tipin are functional orthologs of their replisome-associated yeast counterparts capable of coordinating replication with genotoxic stress responses, and distinguishes mammalian TIM from the circadian-specific paralogs.
17116885 observation explains the similar checkpoint phenotypes observed in both Tipin- and Timeless-depleted cells
More...

AA Sequence

MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGAPVRVPPKRTVKRNIPKLDAQ      1 - 70
RLISERGLPALRHVFDKAKFKGKGHEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCL     71 - 140
KRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELSRSLTEEQQQRIERNKQLA    141 - 210
LERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIANTLNEEETLLD    211 - 280
QSFKNVQQQLDATSRNITEAR                                                     281 - 301
//

Text Mined References (27)

PMID Year Title
26004086 2015 TIPIN depletion leads to apoptosis in breast cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24910198 2014 Structure of RPA32 bound to the N-terminus of SMARCAL1 redefines the binding interface between RPA32 and its interacting proteins.
24126761 2013 hPrimpol1/CCDC111 is a human DNA primase-polymerase required for the maintenance of genome integrity.
23511638 2013 The human Tim-Tipin complex interacts directly with DNA polymerase epsilon and stimulates its synthetic activity.
23359676 2013 Human Tim-Tipin complex affects the biochemical properties of the replicative DNA helicase and DNA polymerases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21490103 2011 The replisome pausing factor Timeless is required for episomal maintenance of latent Epstein-Barr virus.
20233725 2010 Tipin-replication protein A interaction mediates Chk1 phosphorylation by ATR in response to genotoxic stress.
20174623 2010 Systematic analysis of circadian genes in a population-based sample reveals association of TIMELESS with depression and sleep disturbance.
More...