Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ependymoma 4679 2.3e-03

Expression

  Differential Expression (1)

Disease log2 FC p
ependymoma 1.300 2.3e-03

AA Sequence

MSTHVAGLGLDKMKLGNPQSFLDQEEADDQQLLEPEAWKTYTERRNALREFLTSDLSPHLLKRHHARMQL      1 - 70
LRKCSYYIEVLPKHLALGDQNPLVLPSALFQLIDPWKFQRMKKVGTAQTKIQLLLLGDLLEQLDHGRAEL     71 - 140
DALLRSPDPRPFLADWALVERRLADVSAVMDSFLTMMVPGRLHVKHRLVSDVSATKIPHIWLMLSTKMPV    141 - 210
VFDRKASAAHQDWARLRWFVTIQPATSEQYELRFRLLDPRTQQECAQCGVIPVAACTFDVRNLLPNRSYK    211 - 280
FTIKRAETSTLVYEPWRDSLTLHTKPEPLEGPALSHSV                                    281 - 318
//

Text Mined References (7)

PMID Year Title