Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.64
PubTator Score 2.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BVT8 D3DX06 Q53AQ2
Symbols DULP
SB144
C7orf21

Gene

Gene RIF (1)

PMID Text
19254477 a novel ubiquitin-like molecule DULP from human dendritic cells was identified.

AA Sequence

MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAE      1 - 70
TPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQV     71 - 140
RLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLL    141 - 210
WYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP                                      211 - 246
//

Text Mined References (16)

PMID Year Title
24240191 2014 Different functions of HOPS isoforms in the cell: HOPS shuttling isoform is determined by RIP cleavage system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21343306 2011 Membrane-associated ubiquitin ligase complex containing gp78 mediates sterol-accelerated degradation of 3-hydroxy-3-methylglutaryl-coenzyme A reductase.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19254477 2009 Cloning and characterization of DULP, a novel ubiquitin-like molecule from human dendritic cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16014383 2005 HOPS: a novel cAMP-dependent shuttling protein involved in protein synthesis regulation.
More...