Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.39
PubTator Score 2.96

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAE      1 - 70
TPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQV     71 - 140
RLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLL    141 - 210
WYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP                                      211 - 246
//

Text Mined References (16)

PMID Year Title