Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.64
PubTator Score 2.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BVT8 D3DX06 Q53AQ2
Symbols DULP
SB144
C7orf21

Gene

  Ortholog (9)

Pathway (1)

Gene RIF (1)

PMID Text
19254477 a novel ubiquitin-like molecule DULP from human dendritic cells was identified.

AA Sequence

MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAE      1 - 70
TPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQV     71 - 140
RLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLL    141 - 210
WYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP                                      211 - 246
//

Text Mined References (16)

PMID Year Title
24240191 2014 Different functions of HOPS isoforms in the cell: HOPS shuttling isoform is determined by RIP cleavage system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21343306 2011 Membrane-associated ubiquitin ligase complex containing gp78 mediates sterol-accelerated degradation of 3-hydroxy-3-methylglutaryl-coenzyme A reductase.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19254477 2009 Cloning and characterization of DULP, a novel ubiquitin-like molecule from human dendritic cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16014383 2005 HOPS: a novel cAMP-dependent shuttling protein involved in protein synthesis regulation.
More...